Property Summary

NCBI Gene PubMed Count 32
PubMed Score 120.86
PubTator Score 56.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7950 6.1e-07
ovarian cancer 8520 4.4e-06
lung cancer 4740 2.6e-04
Waldenstrons macroglobulinemia 765 2.7e-03
dermatomyositis 966 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Liver disease 237 0.0 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
dermatomyositis 1.200 1.2e-02
lung cancer 1.300 2.6e-04
osteosarcoma -2.431 6.1e-07
ovarian cancer 2.800 4.4e-06
Waldenstrons macroglobulinemia 1.077 2.7e-03

Gene RIF (13)

AA Sequence

MGTVHARSLEPLPSSGPDFGGLGEEAEFVEVEPEAKQEILENKDVVVQHVHFDGLGRTKDDIIICEIGDV      1 - 70
FKAKNLIEVMRKSHEAREKLLRLGIFRQVDVLIDTCQGDDALPNGLDVTFEVTELRRLTGSYNTMVGNNE     71 - 140
GSMVLGLKLPNLLGRAEKVTFQFSYGTKETSYGLSFFKPRPGNFERNFSVNLYKVTGQFPWSSLRETDRG    141 - 210
MSAEYSFPIWKTSHTVKWEGVWRELGCLSRTASFAVRKESGHSLKSSLSHAMVIDSRNSSILPRRGALLK    211 - 280
VNQELAGYTGGDVSFIKEDFELQLNKQLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSIRGFSM    281 - 350
HSIGPQSEGDYLGGEAYWAGGLHLYTPLPFRPGQGGFGELFRTHFFLNAGNLCNLNYGEGPKAHIRKLAE    351 - 420
CIRWSYGAGIVLRLGNIARLELNYCVPMGVQTGDRICDGVQFGAGIRFL                         421 - 469
//

Text Mined References (38)

PMID Year Title