Property Summary

NCBI Gene PubMed Count 36
PubMed Score 18.48
PubTator Score 21.39

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y4X4 A8K5T2 L0R3J4 Q5VZM7 Q9UHZ0
Symbols AP2REP
AP-2rep
HSPC122

Gene

Gene RIF (13)

PMID Text
26223982 Elevated KLF12 expression was accompanied by decreased FOXO1 expression in the endometria of patients with repeated implantation failure.
23458459 overexpression of KLF12 in endometrial stromal cells significantly repressed the expression and secretion of decidualization biomarker genes and their products decidual prolactin and insulin-like growth factor binding protein-1
22150086 The KLF12 rs1324913 A allele homozygous genotype is a possible predictor of Rheumatoid Arthritis.
21658422 no association of genetic polymorphism with rheumatoid arthritis in Spanish and Dutch cohorts
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20049410 Observational study of gene-disease association. (HuGE Navigator)
19907058 In a large UK cohort of patients with rheumatoid arthritis, results have failed to add to the evidence for association at the KLF12 locus reported to be associated with rheumatoid arthritis in independent Spanish cohorts.
19907058 Observational study of gene-disease association. (HuGE Navigator)
19588488 Overexpression of Kruppel-like factor 12 is associated with gastric cancer progression.
19240061 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSL      1 - 70
SVDHFQTQTEPVDLSINKARTSPTAVSSSPVSMTASASSPSSTSTSSSSSSRLASSPTVITSVSSASSSS     71 - 140
TVLTPGPLVASASGVGGQQFLHIIHPVPPSSPMNLQSNKLSHVHRIPVVVQSVPVVYTAVRSPGNVNNTI    141 - 210
VVPLLEDGRGHGKAQMDPRGLSPRQSKSDSDDDDLPNVTLDSVNETGSTALSIARAVQEVHPSPVSRVRG    211 - 280
NRMNNQKFPCSISPFSIESTRRQRRSESPDSRKRRIHRCDFEGCNKVYTKSSHLKAHRRTHTGEKPYKCT    281 - 350
WEGCTWKFARSDELTRHYRKHTGVKPFKCADCDRSFSRSDHLALHRRRHMLV                      351 - 402
//

Publication (41)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26223982 2015 Krüppel-like factor 12 is a novel negative regulator of forkhead box O1 expression: a potential role in impaired decidualization.
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23458459 2013 Krüppel-like factor 12 negatively regulates human endometrial stromal cell decidualization.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...