Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.87
PubTator Score 8.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.800 1.1e-02
Atopic dermatitis 1.200 1.2e-03
Breast cancer 2.200 2.9e-02
esophageal adenocarcinoma 1.300 2.3e-02
gastric carcinoma 1.200 1.7e-02
intraductal papillary-mucinous adenoma (... 1.700 7.4e-03
intraductal papillary-mucinous carcinoma... 1.600 1.8e-02
lung cancer -1.100 2.0e-02
medulloblastoma -1.100 7.0e-03
osteosarcoma -2.206 2.1e-06
ovarian cancer 1.200 5.3e-04
Pick disease 1.300 7.4e-04
psoriasis 1.500 2.5e-08

 GO Process (1)

 Compartment GO Term (2)

Gene RIF (7)

AA Sequence

MAGMDSGNLKTARLWRDAALRARKLRSNLRQLTLTAAGACPGAGADALESPASPQLVLPANLGDIEALNL      1 - 70
GNNGLEEVPEGLGSALGSLRVLVLRRNRFARLPPAVAELGHHLTELDVSHNRLTALGAEVVSALRELRKL     71 - 140
NLSHNQLPALPAQLGALAHLEELDVSFNRLAHLPDSLSCLSRLRTLDVDHNQLTAFPRQLLQLVALEELD    141 - 210
VSSNRLRGLPEDISALRALKILWLSGAELGTLPAGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNL    211 - 280
SSNLFEEFPAALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQ    281 - 350
GNQIAVLPDHFGQLSRVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAA    351 - 420
GKTLLRHCLTEERVEGCPGGGDKEKCYPPSPPPVSKGIEVTSWTADASRGLRFIVYDLAGDESYEVIQPF    421 - 490
FLSPGALYVLVVNLATYEPRHFPTTVGSFLHRVGARVPHAVVCIVGTHADLCGERELEEKCLDIHRQIAL    491 - 560
QEKHDAEGLSRLAKVVDEALARDFELRSASPHAAYYGVSDKNLRRRKAHFQYLLNHRLQILSPVLPVSCR    561 - 630
DPRHLRRLRDKLLSVAEHREIFPNLHRVLPRSWQVLEELHFQPPQAQRLWLSWWDSARLGLQAGLTEDRL    631 - 700
QSALSYLHESGKLLYFEDSPALKEHVFHNLTRLIDILNVFFQRDPSLLLHKLLLGTSGEGKAEGESSPPM    701 - 770
ARSTPSQELLRATQLHQYVEGFLLHGLLPAHVIRLLLKPHVQAQQDLQLLLELLEKMGLCYCLNKPKGKP    771 - 840
LNGSTAWYKFPCYVQNEVPHAEAWINGTNLAGQSFVAEQLQIEYSFPFTFPLGLFARYSVQINSHVVHRS    841 - 910
DGKFQIFAYRGKVPVVVSYRPARGVLQPDTLSIASHASLPNIWTAWQAITPLVEELNVLLQEWPGLHYTV    911 - 980
HILCSKCLKRGSPNPHAFPGELLSQPRPEGVAEIICPKNGSERVNVALVYPPTPTVISPCSKKNVGEKHR    981 - 1050
NQ                                                                       1051 - 1052
//

Text Mined References (19)

PMID Year Title