Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.60
PubTator Score 2.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active ulcerative colitis 3.291 2.2e-02
Astrocytoma, Pilocytic -1.100 2.9e-02
atypical teratoid / rhabdoid tumor -2.100 1.4e-02
colon cancer -1.600 1.1e-02
ependymoma -1.200 1.1e-02
glioblastoma -1.400 3.9e-03
interstitial cystitis -1.700 1.8e-03
lung cancer 4.200 2.5e-07
malignant mesothelioma 1.600 2.6e-07
medulloblastoma, large-cell -1.700 8.7e-03
nasopharyngeal carcinoma 1.300 2.3e-03
non primary Sjogren syndrome sicca -1.100 2.1e-02
non-small cell lung cancer 1.733 4.4e-12
pediatric high grade glioma -1.200 3.0e-02
psoriasis 1.100 1.0e-07
subependymal giant cell astrocytoma -3.567 9.2e-03

Gene RIF (4)

AA Sequence

METLNGPAGGGAPDAKLQPPGQHHRHHHLHPVAERRRLHRAPSPARPFLKDLHARPAAPGPAVPSSGRAP      1 - 70
APAAPRSPNLAGKAPPSPGSLAAPGRLSRRSGGVPGAKDKPPPGAGARAAGGAKAALGSRRAARVAPAEP     71 - 140
LSRAGKPPGAEPPSAAAKGRKAKRGSRAPPARTVGPPTPAARIPAVTLAVTSVAGSPARCSRISHTDSSS    141 - 210
DLSDCPSEPLSDEQRLLPAASSDAESGTGSSDREPPRGAPTPSPAARGAPPGSPEPPALLAAPLAAGACP    211 - 280
GGRSIPSGVSGGFAGPGVAEDVRGRSPPERPVPGTPKEPSLGEQSRLVPAAEEEELLREMEELRSENDYL    281 - 350
KDELDELRAEMEEMRDSYLEEDVYQLQELRRELDRANKNCRILQYRLRKAEQKSLKVAETGQVDGELIRS    351 - 420
LEQDLKVAKDVSVRLHHELKTVEEKRAKAEDENETLRQQMIEVEISKQALQNELERLKESSLKRRSTREM    421 - 490
YKEKKTFNQDDSADLRCQLQFAKEEAFLMRKKMAKLGREKDELEQELQKYKSLYGDVDSPLPTGEAGGPP    491 - 560
STREAELKLRLKLVEEEANILGRKIVELEVENRGLKAEMEDMRGQQEREGPGRDHAPSIPTSPFGDSLES    561 - 630
STELRRHLQFVEEEAELLRRSISEIEDHNRQLTHELSKFKFEPPREPGWLGEGASPGAGGGAPLQEELKS    631 - 700
ARLQISELSGKVLKLQHENHALLSNIQRCDLAAHLGLRAPSPRDSDAESDAGKKESDGEESRLPQPKREG    701 - 770
PVGGESDSEEMFEKTSGFGSGKPSEASEPCPTELLKAREDSEYLVTLKHEAQRLERTVERLITDTDSFLH    771 - 840
DAGLRGGAPLPGPGLQGEEEQGEGDQQEPQLLGTINAKMKAFKKELQAFLEQVNRIGDGLSPLPHLTESS    841 - 910
SFLSTVTSVSRDSPIGNLGKELGPDLQSRLKEQLEWQLGPARGDERESLRLRAARELHRRADGDTGSHGL    911 - 980
GGQTCFSLEMEEEHLYALRWKELEMHSLALQNTLHERTWSDEKNLMQQELRSLKQNIFLFYVKLRWLLKH    981 - 1050
WRQGKQMEEEGEEFTEGEHPETLSRLGELGVQGGHQADGPDHDSDRGCGFPVGEHSPHSRVQIGDHSLRL   1051 - 1120
QTADRGQPHKQVVENQQLFSAFKALLEDFRAELREDERARLRLQQQYASDKAAWDVEWAVLKCRLEQLEE   1121 - 1190
KTENKLGELGSSAESKGALKKEREVHQKLLADSHSLVMDLRWQIHHSEKNWNREKVELLDRLDRDRQEWE   1191 - 1260
RQKKEFLWRIEQLQKENSPRRGGSFLCDQKDGNVRPFPHQGSLRMPRPVAMWPCADADSIPFEDRPLSKL   1261 - 1330
KESDRCSASENLYLDALSLDDEPEEPPAHRPEREFRNRLPEEEENHKGNLQRAVSVSSMSEFQRLMDISP   1331 - 1400
FLPEKGLPSTSSKEDVTPPLSPDDLKYIEEFNKSWDYTPNRGHNGGGPDLWADRTEVGRAGHEDSTEPFP   1401 - 1470
DSSWYLTTSVTMTTDTMTSPEHCQKQPLRSHVLTEQSGLRVLHSPPAVRRVDSITAAGGEGPFPTSRARG   1471 - 1540
SPGDTKGGPPEPMLSRWPCTSPRHSRDYVEGARRPLDSPLCTSLGFASPLHSLEMSKNLSDDMKEVAFSV   1541 - 1610
RNAICSGPGELQVKDMACQTNGSRTMGTQTVQTISVGLQTEALRGSGVTSSPHKCLTPKAGGGATPVSSP   1611 - 1680
SRSLRSRQVAPAIEKVQAKFERTCCSPKYGSPKLQRKPLPKADQPNNRTSPGMAQKGYSESAWARSTTTR   1681 - 1750
ESPVHTTINDGLSSLFNIIDHSPVVQDPFQKGLRAGSRSRSAEPRPELGPGQETGTNSRGRSPSPIGVGS   1751 - 1820
EMCREEGGEGTPVKQDLSAPPGYTLTENVARILNKKLLEHALKEERRQAAHGPPGLHSDSHSLGDTAEPG   1821 - 1890
PMENQTVLLTAPWGL                                                          1891 - 1905
//

Text Mined References (21)

PMID Year Title