Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.46
PubTator Score 0.50

Knowledge Summary

Patent (234)

Synonym

Accession Q9Y4A9 Q6IFQ2 Q96R59
Symbols

Gene

PANTHER Protein Class (2)

AA Sequence

MQRANHSTVTQFILVGFSVFPHLQLMLFLLFLLMYLFTLLGNLLIMATVWSERSLHTPMYLFLCALSVSE      1 - 70
ILYTVAIIPRMLADLLSTQRSIAFLACASQMFFSFSFGFTHSFLLTVMGYDRYVAICHPLRYNVLMSPRG     71 - 140
CACLVGCSWAGGLVMGMVVTSAIFHLAFCGHKEIHHFACHVPPLLKLACGDDVLVVAKGVGLVCITALLG    141 - 210
CFLLILLSYAFIVAAILKIPSAEGRNKAFSTCASHLTVVVVHYGFASVIYLKPKSPQSLEGDTLMGITYT    211 - 280
VLTPFLSPIIFSLRNKELKVAMKKTFFSKLYPEKNVMM                                    281 - 318
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.