Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.46
PubTator Score 0.50

Knowledge Summary

Patent (234)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

AA Sequence

MQRANHSTVTQFILVGFSVFPHLQLMLFLLFLLMYLFTLLGNLLIMATVWSERSLHTPMYLFLCALSVSE      1 - 70
ILYTVAIIPRMLADLLSTQRSIAFLACASQMFFSFSFGFTHSFLLTVMGYDRYVAICHPLRYNVLMSPRG     71 - 140
CACLVGCSWAGGLVMGMVVTSAIFHLAFCGHKEIHHFACHVPPLLKLACGDDVLVVAKGVGLVCITALLG    141 - 210
CFLLILLSYAFIVAAILKIPSAEGRNKAFSTCASHLTVVVVHYGFASVIYLKPKSPQSLEGDTLMGITYT    211 - 280
VLTPFLSPIIFSLRNKELKVAMKKTFFSKLYPEKNVMM                                    281 - 318
//

Text Mined References (5)

PMID Year Title