Property Summary

NCBI Gene PubMed Count 22
PubMed Score 18.55
PubTator Score 11.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 1.543 6.8e-03
active ulcerative colitis 1.340 9.0e-03
atypical teratoid / rhabdoid tumor 2.800 3.0e-05
chronic rhinosinusitis 1.343 1.3e-02
colon cancer 1.500 2.3e-07
cystic fibrosis 2.856 9.4e-08
ductal carcinoma in situ 1.200 2.0e-02
glioblastoma 1.200 2.8e-03
group 3 medulloblastoma 1.600 2.7e-04
interstitial cystitis 1.200 1.6e-02
intraductal papillary-mucinous adenoma (... 1.300 2.1e-03
intraductal papillary-mucinous carcinoma... 2.000 3.5e-05
intraductal papillary-mucinous neoplasm ... 2.000 7.2e-04
invasive ductal carcinoma 2.200 2.6e-02
lung adenocarcinoma 1.200 6.9e-05
malignant mesothelioma 1.600 5.1e-07
medulloblastoma, large-cell 2.600 6.3e-06
nasopharyngeal carcinoma 1.800 6.4e-05
non-small cell lung cancer 1.436 5.7e-13
osteosarcoma -2.146 1.2e-05
ovarian cancer 1.200 8.7e-04
pancreatic cancer 1.800 9.2e-07
pediatric high grade glioma 1.400 1.3e-02
primary Sjogren syndrome 1.100 5.1e-03
primitive neuroectodermal tumor 1.400 1.5e-02
psoriasis 1.400 7.2e-15
sarcoidosis 1.600 4.4e-02

Gene RIF (10)

AA Sequence

MKHLKRWWSAGGGLLHLTLLLSLAGLRVDLDLYLLLPPPTLLQDELLFLGGPASSAYALSPFSASGGWGR      1 - 70
AGHLHPKGRELDPAAPPEGQLLREVRALGVPFVPRTSVDAWLVHSVAAGSADEAHGLLGAAAASSTGGAG     71 - 140
ASVDGGSQAVQGGGGDPRAARSGPLDAGEEEKAPAEPTAQVPDAGGCASEENGVLREKHEAVDHSSQHEE    141 - 210
NEERVSAQKENSLQQNDDDENKIAEKPDWEAEKTTESRNERHLNGTDTSFSLEDLFQLLSSQPENSLEGI    211 - 280
SLGDIPLPGSISDGMNSSAHYHVNFSQAISQDVNLHEAILLCPNNTFRRDPTARTSQSQEPFLQLNSHTT    281 - 350
NPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYDLDINIFDEINLMSLATEDNFDPIDVSQLFDEPDSDSG    351 - 420
LSLDSSHNNTSVIKSNSSHSVCDEGAIGYCTDHESSSHHDLEGAVGGYYPEPSKLCHLDQSDSDFHGDLT    421 - 490
FQHVFHNHTYHLQPTAPESTSEPFPWPGKSQKIRSRYLEDTDRNLSRDEQRAKALHIPFSVDEIVGMPVD    491 - 560
SFNSMLSRYYLTDLQVSLIRDIRRRGKNKVAAQNCRKRKLDIILNLEDDVCNLQAKKETLKREQAQCNKA    561 - 630
INIMKQKLHDLYHDIFSRLRDDQGRPVNPNHYALQCTHDGSILIVPKELVASGHKKETQKGKRK          631 - 694
//

Text Mined References (22)

PMID Year Title