Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.92
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer 1.200 0.009
hepatocellular carcinoma 1.300 0.000
pancreatic cancer 1.100 0.023
psoriasis -2.400 0.000
osteosarcoma -1.179 0.003
tuberculosis and treatment for 6 months -1.700 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.015
colon cancer 1.600 0.032
lung cancer 2.000 0.002
pancreatic carcinoma 1.100 0.023
invasive ductal carcinoma -1.200 0.025

AA Sequence

MSGKRKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKS      1 - 70
MKPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRAEFFFYALGMDGDFNPSAGWLTRFKQRHSIREINI     71 - 140
RNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRISVIKGKCTVPGHKSIEERVT    141 - 210
IMCCANATGLHKLKLCVVGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRS    211 - 280
KGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQNNLEEG    281 - 350
NDLKSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKKILPMVEEKESLDFDVEDISVATVAAILQHTKGL    351 - 420
ENVTTENLEKWLEVDSTEPGYEVLTDSEIIRRAQGQADESSENEEEEIELIPEKHINHAAALQWTENLLD    421 - 490
YLEQQGDMILPDRLVIRKLRATIRNKQKMTKSSQ                                        491 - 524
//

Text Mined References (9)

PMID Year Title
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22648509 2012 PKNOX2 is associated with formal thought disorder in schizophrenia: a meta-analysis of two genome-wide association studies.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9240447 1997 Cloning, mapping, and tissue distribution of a human homologue of the mouse jerky gene product.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.