Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.92
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.34558812656305E-4
tuberculosis and treatment for 6 months 686 1.79190797412748E-4
hepatocellular carcinoma 550 1.87520539739766E-4
lung cancer 4473 0.0017769210591892
osteosarcoma 7933 0.00278049829523609
gastric cancer 436 0.00900891201422237
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0151135067652331
pancreatic cancer 2300 0.0230498137210783
pancreatic carcinoma 567 0.0230498137210784
invasive ductal carcinoma 2950 0.0248580945611415
colon cancer 1475 0.03207528802647

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer 1.200 0.009
hepatocellular carcinoma 1.300 0.000
pancreatic cancer 1.100 0.023
psoriasis -2.400 0.000
osteosarcoma -1.179 0.003
tuberculosis and treatment for 6 months -1.700 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.015
colon cancer 1.600 0.032
lung cancer 2.000 0.002
pancreatic carcinoma 1.100 0.023
invasive ductal carcinoma -1.200 0.025

Synonym

Accession Q9Y4A0 A8K3G4 B2RAJ3 Q32MC2
Symbols HHMJG

Gene

  Ortholog (7)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid

AA Sequence

MSGKRKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKS      1 - 70
MKPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRAEFFFYALGMDGDFNPSAGWLTRFKQRHSIREINI     71 - 140
RNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRISVIKGKCTVPGHKSIEERVT    141 - 210
IMCCANATGLHKLKLCVVGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRS    211 - 280
KGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQNNLEEG    281 - 350
NDLKSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKKILPMVEEKESLDFDVEDISVATVAAILQHTKGL    351 - 420
ENVTTENLEKWLEVDSTEPGYEVLTDSEIIRRAQGQADESSENEEEEIELIPEKHINHAAALQWTENLLD    421 - 490
YLEQQGDMILPDRLVIRKLRATIRNKQKMTKSSQ                                        491 - 524
//

Text Mined References (9)

PMID Year Title
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22648509 2012 PKNOX2 is associated with formal thought disorder in schizophrenia: a meta-analysis of two genome-wide association studies.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9240447 1997 Cloning, mapping, and tissue distribution of a human homologue of the mouse jerky gene product.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.