Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.64
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
colon cancer 1.600 3.2e-02
gastric cancer 1.200 9.0e-03
hepatocellular carcinoma 1.300 1.9e-04
intraductal papillary-mucinous neoplasm ... 1.200 1.5e-02
invasive ductal carcinoma -1.200 2.5e-02
lung cancer 1.500 1.2e-03
osteosarcoma -1.179 2.8e-03
pancreatic cancer 1.100 2.3e-02
pancreatic carcinoma 1.100 2.3e-02
psoriasis -2.400 1.3e-04
tuberculosis and treatment for 3 months -1.200 2.2e-03

Synonym

Accession Q9Y4A0 A8K3G4 B2RAJ3 Q32MC2
Symbols HHMJG

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

AA Sequence

MSGKRKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKS      1 - 70
MKPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRAEFFFYALGMDGDFNPSAGWLTRFKQRHSIREINI     71 - 140
RNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRISVIKGKCTVPGHKSIEERVT    141 - 210
IMCCANATGLHKLKLCVVGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRS    211 - 280
KGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQNNLEEG    281 - 350
NDLKSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKKILPMVEEKESLDFDVEDISVATVAAILQHTKGL    351 - 420
ENVTTENLEKWLEVDSTEPGYEVLTDSEIIRRAQGQADESSENEEEEIELIPEKHINHAAALQWTENLLD    421 - 490
YLEQQGDMILPDRLVIRKLRATIRNKQKMTKSSQ                                        491 - 524
//

Text Mined References (9)

PMID Year Title