Property Summary

NCBI Gene PubMed Count 8
Grant Count 11
R01 Count 7
Funding $378,989.27
PubMed Score 51.99
PubTator Score 50.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
25923537 the F61L/S86F mutant of MTF2 Tudor-PHD1 was able to bind to H3K36me3 as strong as the PHF1 Tudor bound to this PTM . We concluded that the hydrophobic patch plays an essential role in binding of these Tudors to methylated chromatin

AA Sequence

MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKIN      1 - 70
ILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDC     71 - 140
SVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPG    141 - 210
DWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVI    211 - 280
HKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRV    281 - 350
PPVPPNVAFKAEKEPEGTSHEFKIKGRKASKPISDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEP    351 - 420
LLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWP    421 - 490
AAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFGAAG    491 - 560
RIACGEKYRVLARRVTLDGKVQYLVEWEGATAS                                         561 - 593
//

Text Mined References (13)

PMID Year Title
25923537 2015 An aromatic cage is required but not sufficient for binding of Tudor domains of the Polycomblike protein family to H3K36me3.
23228662 2013 Tudor domains of the PRC2 components PHF1 and PHF19 selectively bind to histone H3K36me3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23142980 2012 Molecular basis for H3K36me3 recognition by the Tudor domain of PHF1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15563832 2004 A novel human homologue of Drosophila polycomblike gene is up-regulated in multiple cancers.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...