Property Summary

NCBI Gene PubMed Count 49
PubMed Score 357.19
PubTator Score 49.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia -1.100 1.9e-02
astrocytic glioma -2.200 3.7e-02
ependymoma -1.300 1.5e-08
glioblastoma -1.400 1.0e-03
group 4 medulloblastoma 1.200 2.5e-02
lung cancer 1.600 3.7e-03
medulloblastoma, large-cell -1.300 8.0e-03
osteosarcoma -2.274 1.5e-06
ovarian cancer -1.900 7.2e-07
pancreatic ductal adenocarcinoma liver m... -1.795 3.8e-04
pediatric high grade glioma -1.100 4.9e-04
psoriasis -2.400 3.0e-04

Protein-protein Interaction (2)

Gene RIF (25)

AA Sequence

MARHRNVRGYNYDEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRRDKPSVEPVEEYDYEDLKESSNSVSN      1 - 70
HQLSGFDQARLYSCLDHMREVLGDAVPDEILIEAVLKNKFDVQKALSGVLEQDRVQSLKDKNEATVSTGK     71 - 140
IAKGKPVDSQTSRSESEIVPKVAKMTVSGKKQTMGFEVPGVSSEENGHSFHTPQKGPPIEDAIASSDVLE    141 - 210
TASKSANPPHTIQASEEQSSTPAPVKKSGKLRQQIDVKAELEKRQGGKQLLNLVVIGHVDAGKSTLMGHM    211 - 280
LYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKD    281 - 350
FIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGLLVRSLGVTQLAVAVNKMDQVNWQQERFQE    351 - 420
ITGKLGHFLKQAGFKESDVGFIPTSGLSGENLITRSQSSELTKWYKGLCLLEQIDSFKPPQRSIDKPFRL    421 - 490
CVSDVFKDQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLHDEPVDWAAAGDHVSLTLVGMDII    491 - 560
KINVGCIFCGPKVPIKACTRFRARILIFNIEIPITKGFPVLLHYQTVSEPAVIKRLISVLNKSTGEVTKK    561 - 630
KPKFLTKGQNALVELQTQRPIALELYKDFKELGRFMLRYGGSTIAAGVVTEIKE                    631 - 684
//

Text Mined References (55)

PMID Year Title