Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.19
PubTator Score 45.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.4e-29
interstitial cystitis 2312 1.4e-03
osteosarcoma 7950 1.6e-03
cutaneous lupus erythematosus 1057 8.3e-03

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 1.400 8.3e-03
interstitial cystitis 1.400 1.4e-03
osteosarcoma -1.451 1.6e-03
psoriasis 1.300 1.4e-29

Gene RIF (3)

AA Sequence

MNQADPRLRAVCLWTLTSAAMSRGDNCTDLLALGIPSITQAWGLWVLLGAVTLLFLISLAAHLSQWTRGR      1 - 70
SRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIP     71 - 140
GPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS                  141 - 196
//

Text Mined References (20)

PMID Year Title