Property Summary

NCBI Gene PubMed Count 18
Grant Count 1
Funding $63,717.67
PubMed Score 3.19
PubTator Score 45.92

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 1.400 0.008
osteosarcoma -1.451 0.002
interstitial cystitis 1.400 0.001
psoriasis 1.300 0.000

Synonym

Accession Q9Y3P8 B2RBP9
Symbols SIT
SIT-R

Gene

 Grant Application (1)

Gene RIF (2)

PMID Text
21957439 SIT as an important modulator of TCR-mediated signaling that regulates T-cell activation, homeostasis and tolerance
19204726 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNQADPRLRAVCLWTLTSAAMSRGDNCTDLLALGIPSITQAWGLWVLLGAVTLLFLISLAAHLSQWTRGR      1 - 70
SRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIP     71 - 140
GPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS                  141 - 196
//

Text Mined References (20)

PMID Year Title
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
21957439 2011 The transmembrane adaptor protein SIT inhibits TCR-mediated signaling.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16160011 2006 Transmembrane adaptor molecules: a new category of lymphoid-cell markers.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15570572 2005 Automated immobilized metal affinity chromatography/nano-liquid chromatography/electrospray ionization mass spectrometry platform for profiling protein phosphorylation sites.
More...