Property Summary

NCBI Gene PubMed Count 21
Grant Count 11
R01 Count 2
Funding $4,067,339
PubMed Score 52.69
PubTator Score 32.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
25378478 RTCB, the catalytic subunit of the tRNA ligase complex, and its co-factor archease mediate XBP1 mRNA splicing both in vitro and in vivo.
24941254 Over-expression of HSPC117 mRNA reduced MMP 2 and MMP 14 mRNA expression, while TIMP 2 mRNA expression was up-regulated.
24608264 hCLE/C14orf166 associates with DDX1, HSPC117, and FAM98B in a novel transcription-dependent shuttling RNA-transporting complex.
22174317 HIV-1 Rev interacting protein, chromosome 22 open reading frame 28 (C22orf28), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
21311021 study identified HSPC117, a member of the UPF0027 (RtcB) family, as the essential subunit of a tRNA ligase complex; RNA interference-mediated depletion of HSPC117 inhibited maturation of intron-containing pre-tRNA both in vitro and in living cells

AA Sequence

MSRSYNDELQFLEKINKNCWRIKKGFVPNMQVEGVFYVNDALEKLMFEELRNACRGGGVGGFLPAMKQIG      1 - 70
NVAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMNDPEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVK     71 - 140
EQLAQAMFDHIPVGVGSKGVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQADPNKVSAR    141 - 210
AKKRGLPQLGTLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKA    211 - 280
MKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDLDLHVIYD    281 - 350
VSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMT    351 - 420
ETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGI    421 - 490
SKKAIKLRPIAVIKG                                                           491 - 505
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25378478 2014 The mammalian tRNA ligase complex mediates splicing of XBP1 mRNA and controls antibody secretion in plasma cells.
25087875 2014 A synthetic biology approach identifies the mammalian UPR RNA ligase RtcB.
24941254 2014 HSPC117 is regulated by epigenetic modification and is involved in the migration of JEG-3 cells.
24870230 2014 Analysis of orthologous groups reveals archease and DDX1 as tRNA splicing factors.
24608264 2014 hCLE/C14orf166 associates with DDX1-HSPC117-FAM98B in a novel transcription-dependent shuttling RNA-transporting complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...