Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.46
PubTator Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 9.27329978035138E-6
acute quadriplegic myopathy 1157 1.59065666754903E-5
adult high grade glioma 2148 3.86556991062243E-5
ovarian cancer 8492 2.06381514085716E-4
glioblastoma 5572 8.85601591732449E-4
medulloblastoma, large-cell 6234 0.00239369262774161
astrocytic glioma 2241 0.00303606750099416
oligodendroglioma 2849 0.00370251872652893
ependymoma 2514 0.00540493352797621
group 3 medulloblastoma 2254 0.0108390784274278
invasive ductal carcinoma 2950 0.0112915214656944
Breast cancer 3099 0.0270162221104319
acute myeloid leukemia 785 0.0386554221968034

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.000 0.003
ependymoma -2.100 0.005
oligodendroglioma -2.000 0.004
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.300 0.001
medulloblastoma, large-cell -1.100 0.002
acute quadriplegic myopathy 1.207 0.000
Breast cancer 2.600 0.027
adult high grade glioma -1.200 0.000
group 3 medulloblastoma 1.200 0.011
invasive ductal carcinoma 1.600 0.011
acute myeloid leukemia -1.400 0.039
ovarian cancer 2.100 0.000

Synonym

Accession Q9Y3D9 B2R6V3 Q96Q24 Q9BWH8 Q9P053 MRP-S23
Symbols CGI-138
HSPC329
MRP-S23

Gene

PDB

3J9M  

  Ortholog (14)

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAGSRLETVGSIFSRTRDLVRAGVLKEKPLWFDVYDAFPPLREPVFQRPRVRYGKAKAPIQDIWYHEDRI      1 - 70
RAKFYSVYGSGQRAFDLFNPNFKSTCQRFVEKYTELQKLGETDEEKLFVETGKALLAEGVILRRVGEART     71 - 140
QHGGSHVSRKSEHLSVRPQTALEENETQKEVPQDQHLEAPADQSKGLLPP                        141 - 190
//

Text Mined References (19)

PMID Year Title
26741492 2016 A Comprehensive Genomic Analysis Reveals the Genetic Landscape of Mitochondrial Respiratory Chain Complex Deficiencies.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...