Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.46
PubTator Score 0.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.000 0.003
ependymoma -2.100 0.005
oligodendroglioma -2.000 0.004
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.300 0.001
medulloblastoma, large-cell -1.100 0.002
acute quadriplegic myopathy 1.207 0.000
Breast cancer 2.600 0.027
adult high grade glioma -1.200 0.000
group 3 medulloblastoma 1.200 0.011
invasive ductal carcinoma 1.600 0.011
acute myeloid leukemia -1.400 0.039
ovarian cancer 2.100 0.000

Synonym

Accession Q9Y3D9 B2R6V3 Q96Q24 Q9BWH8 Q9P053 MRP-S23
Symbols CGI-138
HSPC329
MRP-S23

Gene

PDB

3J9M  

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAGSRLETVGSIFSRTRDLVRAGVLKEKPLWFDVYDAFPPLREPVFQRPRVRYGKAKAPIQDIWYHEDRI      1 - 70
RAKFYSVYGSGQRAFDLFNPNFKSTCQRFVEKYTELQKLGETDEEKLFVETGKALLAEGVILRRVGEART     71 - 140
QHGGSHVSRKSEHLSVRPQTALEENETQKEVPQDQHLEAPADQSKGLLPP                        141 - 190
//

Text Mined References (19)

PMID Year Title
26741492 2016 A Comprehensive Genomic Analysis Reveals the Genetic Landscape of Mitochondrial Respiratory Chain Complex Deficiencies.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...