Property Summary

NCBI Gene PubMed Count 17
PubMed Score 227.64
PubTator Score 17.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

AA Sequence

MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSP      1 - 70
EEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT                    71 - 125
//

Text Mined References (17)

PMID Year Title