Property Summary

NCBI Gene PubMed Count 14
Grant Count 3
Funding $30,145.2
PubMed Score 202.39
PubTator Score 17.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Expression

Synonym

Accession Q9Y3D7 Q6I9Z3 Q9H5X3
Symbols TIM16
MAGMAS
SMDMDM
TIMM16
CGI-136

Gene

PANTHER Protein Class (1)

Gene RIF (5)

PMID Text
25165880 A novel essential role of Magmas is a 'ROS regulatory protein' in the maintenance of cellular redox homeostasis and imparting cytoprotection under oxidative stress.
24786642 finding of deleterious MAGMAS mutations in an early lethal skeletal dysplasia supports a key role for this mitochondrial protein in the ossification process
20877624 Observational study of gene-disease association. (HuGE Navigator)
20719856 Magmas protects pituitary cells from apoptosis, suggesting its possible involvement in neoplastic transformation.
15704001 Magmas expression in prostate cancer.

AA Sequence

MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSP      1 - 70
EEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT                    71 - 125
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25165880 2014 Magmas functions as a ROS regulator and provides cytoprotection against oxidative stress-mediated damages.
24786642 2014 The impairment of MAGMAS function in human is responsible for a severe skeletal dysplasia.
23263864 2013 Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20719856 2010 Magmas, a gene newly identified as overexpressed in human and mouse ACTH-secreting pituitary adenomas, protects pituitary cells from apoptotic stimuli.
20053669 2010 Role of Magmas in protein transport and human mitochondria biogenesis.
19564938 2009 The mitochondrial protein translocation motor: structural conservation between the human and yeast Tim14/Pam18-Tim16/Pam16 co-chaperones.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15704001 2005 Magmas expression in neoplastic human prostate.
More...