Property Summary

NCBI Gene PubMed Count 14
PubMed Score 202.39
PubTator Score 17.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y3D7 Q6I9Z3 Q9H5X3
Symbols TIM16
MAGMAS
SMDMDM
TIMM16
CGI-136

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 MGI Term (1)

Gene RIF (5)

PMID Text
25165880 A novel essential role of Magmas is a 'ROS regulatory protein' in the maintenance of cellular redox homeostasis and imparting cytoprotection under oxidative stress.
24786642 finding of deleterious MAGMAS mutations in an early lethal skeletal dysplasia supports a key role for this mitochondrial protein in the ossification process
20877624 Observational study of gene-disease association. (HuGE Navigator)
20719856 Magmas protects pituitary cells from apoptosis, suggesting its possible involvement in neoplastic transformation.
15704001 Magmas expression in prostate cancer.

AA Sequence

MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSP      1 - 70
EEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT                    71 - 125
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25165880 2014 Magmas functions as a ROS regulator and provides cytoprotection against oxidative stress-mediated damages.
24786642 2014 The impairment of MAGMAS function in human is responsible for a severe skeletal dysplasia.
23263864 2013 Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20719856 2010 Magmas, a gene newly identified as overexpressed in human and mouse ACTH-secreting pituitary adenomas, protects pituitary cells from apoptotic stimuli.
20053669 2010 Role of Magmas in protein transport and human mitochondria biogenesis.
19564938 2009 The mitochondrial protein translocation motor: structural conservation between the human and yeast Tim14/Pam18-Tim16/Pam16 co-chaperones.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15704001 2005 Magmas expression in neoplastic human prostate.
More...