Property Summary

NCBI Gene PubMed Count 22
PubMed Score 71.48
PubTator Score 55.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.400 8.2e-04
astrocytic glioma -1.100 1.3e-02
dermatomyositis 1.300 4.0e-04
ductal carcinoma in situ -1.100 8.2e-05
ependymoma -1.200 2.8e-02
group 4 medulloblastoma 1.100 3.2e-03
malignant mesothelioma -2.400 5.1e-07
medulloblastoma, large-cell -1.800 2.3e-05
Multiple myeloma 1.375 5.7e-03
osteosarcoma -1.280 9.3e-05
ovarian cancer -1.900 4.2e-07
pancreatic cancer 1.600 5.7e-04
pancreatic ductal adenocarcinoma liver m... -1.620 1.9e-02
tuberculosis 2.200 8.2e-07

Synonym

Accession Q9Y3D2 Q17R44 Q4G1C7 Q9Y5W6 MsrB2
Symbols CBS1
MSRB
PILB
CBS-1
CGI-131

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (6)

Gene RIF (16)

AA Sequence

MARLLWLLRGLTLGTAPRRAVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTPEQFYVTREKG      1 - 70
TEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSA     71 - 140
RTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH                                141 - 182
//

Text Mined References (26)

PMID Year Title