Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.21
PubTator Score 2.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.003 0.044
Multiple myeloma 1.362 0.003
astrocytoma 1.100 0.000
glioblastoma 1.300 0.010
oligodendroglioma 1.200 0.000
group 3 medulloblastoma 1.900 0.000
medulloblastoma, large-cell 1.100 0.002
primitive neuroectodermal tumor 1.400 0.001
hereditary spastic paraplegia -1.426 0.004
limb girdle muscular dystrophy 2A -1.020 0.001
lung cancer 1.600 0.000
breast carcinoma 1.400 0.003
ovarian cancer 1.100 0.029

AA Sequence

MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKM      1 - 70
KTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIM     71 - 140
NITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL                                       141 - 175
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
22912744 2012 The human EKC/KEOPS complex is recruited to Cullin2 ubiquitin ligases by the human tumour antigen PRAME.
21931564 2011 A genome-wide metabolic QTL analysis in Europeans implicates two loci shaped by recent positive selection.
21269460 2011 Initial characterization of the human central proteome.
20383145 2010 Genetic loci influencing kidney function and chronic kidney disease.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18951093 2008 Atomic structure of the KEOPS complex: an ancient protein kinase-containing molecular machine.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...