Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma 5572 1.24251378533987E-7
posterior fossa group A ependymoma 1511 1.09365105459033E-6
lung cancer 4473 5.47005325025279E-6
pediatric high grade glioma 2712 8.09753830294145E-6
ductal carcinoma in situ 1745 6.6327416414163E-5
pilocytic astrocytoma 3086 1.59364176600769E-4
psoriasis 6685 2.31508507915632E-4
osteosarcoma 7933 5.63116271555322E-4
dermatomyositis 967 6.97782286535797E-4
atypical teratoid/rhabdoid tumor 1095 0.00146593851756322
nasopharyngeal carcinoma 1056 0.00160838739481416
invasive ductal carcinoma 2950 0.00171740037043037
primitive neuroectodermal tumor 3031 0.00205827180728348
group 3 medulloblastoma 2254 0.00455321611961731
ovarian cancer 8492 0.0101463819893234

Expression

  Differential Expression (15)

Disease log2 FC p
posterior fossa group A ependymoma 1.400 0.000
psoriasis -1.800 0.000
glioblastoma 1.800 0.000
osteosarcoma -1.842 0.001
primitive neuroectodermal tumor 1.200 0.002
lung cancer 2.300 0.000
pediatric high grade glioma 1.600 0.000
atypical teratoid/rhabdoid tumor 1.100 0.001
group 3 medulloblastoma 1.500 0.005
pilocytic astrocytoma 1.300 0.000
nasopharyngeal carcinoma 1.200 0.002
ductal carcinoma in situ 1.100 0.000
invasive ductal carcinoma 1.300 0.002
ovarian cancer 1.400 0.010
dermatomyositis 1.300 0.001

Synonym

Accession Q9Y3B9
Symbols CGI-115
KIAA0507

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (1)

PMID Text
15769876 The budding yeast homolog of human RRP15 is required for maturation of 60S ribosomal particles

AA Sequence

MAAAAPDSRVSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGD      1 - 70
AEPCDKENENDGESSVGTNMGWADAMAKVLNKKTPESKPTILVKNKKLEKEKEKLKQERLEKIKQRDKRL     71 - 140
EWEMMCRVKPDVVQDKETERNLQRIATRGVVQLFNAVQKHQKNVDEKVKEAGSSMRKRAKLISTVSKKDF    141 - 210
ISVLRGMDGSTNETASSRKKPKAKQTEVKSEEGPGWTILRDDFMMGASMKDWDKESDGPDDSRPESASDS    211 - 280
DT                                                                        281 - 282
//

Text Mined References (19)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...