Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.100 7.0e-03
Astrocytoma, Pilocytic 1.400 1.9e-04
atypical teratoid/rhabdoid tumor 1.100 1.5e-03
dermatomyositis 1.300 7.0e-04
ductal carcinoma in situ 1.100 6.6e-05
ependymoma -1.100 3.8e-02
glioblastoma 1.800 1.2e-07
group 3 medulloblastoma 1.100 8.0e-03
invasive ductal carcinoma 1.300 1.7e-03
lung cancer 1.600 4.1e-05
nasopharyngeal carcinoma 1.200 1.6e-03
osteosarcoma -1.842 5.6e-04
ovarian cancer 1.400 1.0e-02
primitive neuroectodermal tumor 1.200 2.1e-03
psoriasis -1.800 2.3e-04

Gene RIF (2)

AA Sequence

MAAAAPDSRVSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGD      1 - 70
AEPCDKENENDGESSVGTNMGWADAMAKVLNKKTPESKPTILVKNKKLEKEKEKLKQERLEKIKQRDKRL     71 - 140
EWEMMCRVKPDVVQDKETERNLQRIATRGVVQLFNAVQKHQKNVDEKVKEAGSSMRKRAKLISTVSKKDF    141 - 210
ISVLRGMDGSTNETASSRKKPKAKQTEVKSEEGPGWTILRDDFMMGASMKDWDKESDGPDDSRPESASDS    211 - 280
DT                                                                        281 - 282
//

Text Mined References (21)

PMID Year Title