Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
posterior fossa group A ependymoma 1.400 0.000
psoriasis -1.800 0.000
glioblastoma 1.800 0.000
osteosarcoma -1.842 0.001
primitive neuroectodermal tumor 1.200 0.002
lung cancer 2.300 0.000
pediatric high grade glioma 1.600 0.000
atypical teratoid/rhabdoid tumor 1.100 0.001
group 3 medulloblastoma 1.500 0.005
pilocytic astrocytoma 1.300 0.000
nasopharyngeal carcinoma 1.200 0.002
ductal carcinoma in situ 1.100 0.000
invasive ductal carcinoma 1.300 0.002
ovarian cancer 1.400 0.010
dermatomyositis 1.300 0.001

Synonym

Accession Q9Y3B9
Symbols CGI-115
KIAA0507

Gene

Gene RIF (1)

PMID Text
15769876 The budding yeast homolog of human RRP15 is required for maturation of 60S ribosomal particles

AA Sequence

MAAAAPDSRVSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGD      1 - 70
AEPCDKENENDGESSVGTNMGWADAMAKVLNKKTPESKPTILVKNKKLEKEKEKLKQERLEKIKQRDKRL     71 - 140
EWEMMCRVKPDVVQDKETERNLQRIATRGVVQLFNAVQKHQKNVDEKVKEAGSSMRKRAKLISTVSKKDF    141 - 210
ISVLRGMDGSTNETASSRKKPKAKQTEVKSEEGPGWTILRDDFMMGASMKDWDKESDGPDDSRPESASDS    211 - 280
DT                                                                        281 - 282
//

Text Mined References (19)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...