Property Summary

NCBI Gene PubMed Count 29
PubMed Score 110.19
PubTator Score 3.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.300 6.6e-03
medulloblastoma, large-cell -1.100 8.3e-04
osteosarcoma -1.437 3.0e-03
ovarian cancer 1.700 5.3e-05

Synonym

Accession Q9Y3B2 B2R9B3 Q5JTH3
Symbols p13
CSL4
SKI4
Csl4p
Ski4p
CGI-108

Gene

PDB

2NN6  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (5)

AA Sequence

MAPPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGCLMKSSENGALPVVSVVRETESQLLPDVGAI      1 - 70
VTCKVSSINSRFAKVHILYVGSMPLKNSFRGTIRKEDVRATEKDKVEIYKSFRPGDIVLAKVISLGDAQS     71 - 140
NYLLTTAENELGVVVAHSESGIQMVPISWCEMQCPKTHTKEFRKVARVQPEFLQT                   141 - 195
//

Text Mined References (34)

PMID Year Title