Property Summary

NCBI Gene PubMed Count 27
Grant Count 90
R01 Count 83
Funding $6,633,031.71
PubMed Score 104.12
PubTator Score 3.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.437 0.003
medulloblastoma, large-cell -1.100 0.001
intraductal papillary-mucinous adenoma (... 1.300 0.007
ovarian cancer 1.700 0.000

Synonym

Accession Q9Y3B2 B2R9B3 Q5JTH3
Symbols p13
CSL4
SKI4
Csl4p
Ski4p
CGI-108

Gene

PDB

2NN6  

 GO Function (1)

Gene RIF (4)

PMID Text
22174317 HIV-1 Rev interacting protein, exosome component 1 (EXOSC1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with EXOSC1 is increased by RRE
22068837 Human exosome hCsl4p participates in RNA degradation.
12419256 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.
11812149 association of hCsl4p with the exosome is mediated by protein-protein interactions with hRrp42p and hRrp46p

AA Sequence

MAPPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGCLMKSSENGALPVVSVVRETESQLLPDVGAI      1 - 70
VTCKVSSINSRFAKVHILYVGSMPLKNSFRGTIRKEDVRATEKDKVEIYKSFRPGDIVLAKVISLGDAQS     71 - 140
NYLLTTAENELGVVVAHSESGIQMVPISWCEMQCPKTHTKEFRKVARVQPEFLQT                   141 - 195
//

Text Mined References (32)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22488912 2012 Bioinformatics analysis reveals transcriptome and microRNA signatures and drug repositioning targets for IBD and other autoimmune diseases.
22068837 2011 Yeast RNA viruses as indicators of exosome activity: human exosome hCsl4p participates in RNA degradation in Saccharomyces cerevisiae'.
21791617 2011 DDX60, a DEXD/H box helicase, is a novel antiviral factor promoting RIG-I-like receptor-mediated signaling.
21269460 2011 Initial characterization of the human central proteome.
21255825 2011 The RNA exosome targets the AID cytidine deaminase to both strands of transcribed duplex DNA substrates.
20531389 2010 Dis3-like 1: a novel exoribonuclease associated with the human exosome.
More...