Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.67
PubTator Score 0.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Platelet mean volume finding 31
Disease Target Count P-value
glioblastoma 5572 2.12211887834403E-8
acute quadriplegic myopathy 1157 5.76561762429272E-7
ependymoma 2514 3.03715291418861E-6
pilocytic astrocytoma 3086 4.12095516844536E-6
pediatric high grade glioma 2712 7.60645222783666E-5
Multiple myeloma 1328 8.4996501085643E-5
sonic hedgehog group medulloblastoma 1482 1.31239485662521E-4
lung adenocarcinoma 2714 1.50387066218431E-4
atypical teratoid/rhabdoid tumor 1095 4.81559892517436E-4
primitive neuroectodermal tumor 3031 5.1020196354988E-4
medulloblastoma, large-cell 6234 0.00123065156514965
primary Sjogren syndrome 789 0.00266248770844894
ovarian cancer 8492 0.00598566428383465
lung cancer 4473 0.00956959321220157
Breast cancer 3099 0.0215258560780546
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0240464829217608
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0255552701143125

Expression

Synonym

Accession Q9Y3B1 E1P5I8 Q5JX17 Q9NUL0
Symbols SLMO2
C20orf45
dJ543J19.5

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG
S.cerevisiae OMA EggNOG

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKIWTSEHVFDHPWETVTTAAMQKYPNPMNPSVVGVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIG      1 - 70
AARTKTYVQEHSVVDPVEKTMELKSTNISFTNMVSVDERLIYKPHPQDPEKTVLTQEAIITVKGVSLSSY     71 - 140
LEGLMASTISSNASKGREAMEWVIHKLNAEIEELTASARGTIRTPMAAAAFAEK                    141 - 194
//

Text Mined References (7)

PMID Year Title
22423221 2012 A meta-analysis and genome-wide association study of platelet count and mean platelet volume in african americans.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.