Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.29
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 4.0e-04
osteosarcoma 1.097 4.1e-03
ovarian cancer 1.100 6.8e-04
psoriasis 1.400 1.3e-03
X-linked cerebral adrenoleukodystrophy -1.300 4.3e-02

 GO Function (1)

AA Sequence

MVARRRKCAARDPEDRIPSPLGYAAIPIKFSEKQQASHYLYVRAHGVRQGTKSTWPQKRTLFVLNVPPYC      1 - 70
TEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLL     71 - 140
VSTESHPVKSGIHKWISDYADSVPDPEALRVEVDTFMEAYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRG    141 - 210
RRPVLPRTEAASLRVLERERRKRSRKELLNFYAWQHRESKMEHLAQLRKKFEEDKQRIELLRAQRKFRPY    211 - 280
//

Text Mined References (14)

PMID Year Title