Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.29
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 4.03926991700479E-4
ovarian cancer 8492 6.78234886920415E-4
psoriasis 6685 0.00129174490065183
osteosarcoma 7933 0.0041375624127828
X-linked cerebral adrenoleukodystrophy 115 0.0427361890068267

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.400 0.001
osteosarcoma 1.097 0.004
atypical teratoid / rhabdoid tumor -1.100 0.000
X-linked cerebral adrenoleukodystrophy -1.300 0.043
ovarian cancer 1.100 0.001

Synonym

Accession Q9Y3A4 A4FTX2 B2RBG4 Q0VAD0 Q5JZ94 Q6P4B5 Q8IVR9 Q8IVY0 Q8N5Q3 Q8NEY6 Q9Y3H5
Symbols CGI-96
BK126B4.3

Gene

  Ortholog (14)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

AA Sequence

MVARRRKCAARDPEDRIPSPLGYAAIPIKFSEKQQASHYLYVRAHGVRQGTKSTWPQKRTLFVLNVPPYC      1 - 70
TEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLL     71 - 140
VSTESHPVKSGIHKWISDYADSVPDPEALRVEVDTFMEAYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRG    141 - 210
RRPVLPRTEAASLRVLERERRKRSRKELLNFYAWQHRESKMEHLAQLRKKFEEDKQRIELLRAQRKFRPY    211 - 280
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...