Property Summary

NCBI Gene PubMed Count 19
PubMed Score 15.00
PubTator Score 6.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma 1.300 3.1e-02
group 3 medulloblastoma 1.100 4.0e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.1e-02
invasive ductal carcinoma 1.600 6.7e-03
medulloblastoma, large-cell -1.300 1.3e-05
non-small cell lung cancer 1.154 1.9e-11
osteosarcoma -1.105 5.6e-04
ovarian cancer 1.200 1.4e-05

Gene RIF (7)

AA Sequence

MATLLRPVLRRLCGLPGLQRPAAEMPLRARSDGAGPLYSHHLPTSPLQKGLLAAGSAAMALYNPYRHDMV      1 - 70
AVLGETTGHRTLKVLRDQMRRDPEGAQILQERPRISTSTLDLGKLQSLPEGSLGREYLRFLDVNRVSPDT     71 - 140
RAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIRLGAQS    141 - 210
LQVLVSELIPWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITAPPMHVQGLA                   211 - 265
//

Text Mined References (21)

PMID Year Title