Property Summary

NCBI Gene PubMed Count 24
PubMed Score 1.58
PubTator Score 3.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.4e-06
dermatomyositis 966 2.0e-04
Waldenstrons macroglobulinemia 765 4.4e-03
ovarian cancer 8520 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
dermatomyositis 1.400 2.0e-04
osteosarcoma -2.433 2.4e-06
ovarian cancer 1.300 1.1e-02
Waldenstrons macroglobulinemia 1.022 4.4e-03

Gene RIF (2)

AA Sequence

MSAQAQMRAMLDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRAD      1 - 70
YEIASKEQDFFFELDAMDHLQSFIADCDRRTEVAKKRLAETQEEISAEVAAKAERVHELNEEIGKLLAKV     71 - 140
EQLGAEGNVEESQKVMDEVEKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHF    141 - 210
GGKLHLGFIEIREKLEELKRVVAEKQEKRNQERLKRREEREREEREKLRRSRSHSKNPKRSRSREHRRHR    211 - 280
SRSMSRERKRRTRSKSREKRHRHRSRSSSRSRSRSHQRSRHSSRDRSRERSKRRSSKERFRDQDLASCDR    281 - 350
DRSSRDRSPRDRDRKDKKRSYESANGRSEDRRSSEEREAGEI                                351 - 392
//

Text Mined References (30)

PMID Year Title