Property Summary

NCBI Gene PubMed Count 24
PubMed Score 1.58
PubTator Score 3.39

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.022 0.004
osteosarcoma -2.433 0.000
ovarian cancer 1.300 0.011
dermatomyositis 1.400 0.000

Synonym

Accession Q9Y383 B7Z500 Q8IUP9 Q9NVL3 Q9NVN7 Q9UQN1
Symbols CGI-59
CGI-74
LUC7B2

Gene

Gene RIF (5)

PMID Text
24429498 Loss of LUC7L2 is associated with myeloid neoplasms.
23125841 Tandem affinity purification and mass spectrometry analysis identify putative RNA-binding protein Luc7-like 2 (LUC7L2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify putative RNA-binding protein Luc7-like 2 (LUC7L2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify putative RNA-binding protein Luc7-like 2 (LUC7L2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify putative RNA-binding protein Luc7-like 2 (LUC7L2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MSAQAQMRAMLDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRAD      1 - 70
YEIASKEQDFFFELDAMDHLQSFIADCDRRTEVAKKRLAETQEEISAEVAAKAERVHELNEEIGKLLAKV     71 - 140
EQLGAEGNVEESQKVMDEVEKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHF    141 - 210
GGKLHLGFIEIREKLEELKRVVAEKQEKRNQERLKRREEREREEREKLRRSRSHSKNPKRSRSREHRRHR    211 - 280
SRSMSRERKRRTRSKSREKRHRHRSRSSSRSRSRSHQRSRHSSRDRSRERSKRRSSKERFRDQDLASCDR    281 - 350
DRSSRDRSPRDRDRKDKKRSYESANGRSEDRRSSEEREAGEI                                351 - 392
//

Text Mined References (30)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24429498 2014 Recurrent genetic defects on chromosome 7q in myeloid neoplasms.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20562859 2010 Network organization of the human autophagy system.
More...