Property Summary

NCBI Gene PubMed Count 7
Grant Count 7
R01 Count 4
Funding $321,391.51
PubMed Score 31.12
PubTator Score 7.63

Knowledge Summary

Patent

No data available

AA Sequence

MVKLNSNPSEKGTKPPSVEDGFQTVPLITPLEVNHLQLPAPEKVIVKTRTEYQPEQKNKGKFRVPKIAEF      1 - 70
TVTILVSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPNSRSRFYTVISHYS     71 - 140
VAKQSTARAIGPWLSAAAVIHEPKPPKTQGH                                           141 - 171
//

Text Mined References (8)

PMID Year Title
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
7829526 1995 A 19-kDa protein belonging to a new family is expressed in the Golgi apparatus of neural cells.