Property Summary

NCBI Gene PubMed Count 8
PubMed Score 32.53
PubTator Score 7.63

Knowledge Summary

Patent

No data available

 GO Function (1)

Protein-protein Interaction (3)

AA Sequence

MVKLNSNPSEKGTKPPSVEDGFQTVPLITPLEVNHLQLPAPEKVIVKTRTEYQPEQKNKGKFRVPKIAEF      1 - 70
TVTILVSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPNSRSRFYTVISHYS     71 - 140
VAKQSTARAIGPWLSAAAVIHEPKPPKTQGH                                           141 - 171
//

Text Mined References (9)

PMID Year Title