Property Summary

NCBI Gene PubMed Count 19
PubMed Score 138.66
PubTator Score 25.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Myopathy with lactic acidosis and sideroblastic anemia 2 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 6.4e-04
Breast cancer 3578 2.6e-02
lung cancer 4740 2.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Lactic acidosis 51 3.861 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 2.700 2.6e-02
lung cancer 1.300 2.8e-02
ovarian cancer 1.300 6.4e-04

Gene RIF (10)

AA Sequence

MAAPILRSFSWGRWSGTLNLSVLLPLGLRKAHSGAQGLLAAQKARGLFKDFFPETGTKIELPELFDRGTA      1 - 70
SFPQTIYCGFDPTADSLHVGHLLALLGLFHLQRAGHNVIALVGGATARLGDPSGRTKEREALETERVRAN     71 - 140
ARALRLGLEALAANHQQLFTDGRSWGSFTVLDNSAWYQKQHLVDFLAAVGGHFRMGTLLSRQSVQLRLKS    141 - 210
PEGMSLAEFFYQVLQAYDFYYLFQRYGCRVQLGGSDQLGNIMSGYEFINKLTGEDVFGITVPLITSTTGA    211 - 280
KLGKSAGNAVWLNRDKTSPFELYQFFVRQPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLA    281 - 350
AEVTKLVHGREGLDSAKRCTQALYHSSIDALEVMSDQELKELFKEAPFSEFFLDPGTSVLDTCRKANAIP    351 - 420
DGPRGYRMITEGGVSINHQQVTNPESVLIVGQHILKNGLSLLKIGKRNFYIIKWLQL                 421 - 477
//

Text Mined References (23)

PMID Year Title