Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.34
PubTator Score 4.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 2.400 0.000
osteosarcoma -1.764 0.000
sonic hedgehog group medulloblastoma 2.200 0.000
glioblastoma 1.100 0.003
primitive neuroectodermal tumor 1.200 0.004
Atopic dermatitis 1.300 0.001

Synonym

Accession Q9Y2V2 B2R4C3 D3DUF5 Q2YDX5 Q9BQ53
Symbols CSDC1
CRHSP24
CRHSP-24

Gene

PDB

3AQQ  

Gene RIF (3)

PMID Text
21990353 CARHSP1 inhibits hepatic gluconeogenic gene expression via repression of PPARalpha
21177848 CRHSP-24 participates in oxidative stress response via a dynamic and temporal association between stress granules and processing bodies.
21078874 Data suggest that CARHSP1 is a TNF-alpha mRNA stability enhancer required for effective TNF-alpha production, demonstrating the importance of both stabilization and destabilization pathways in regulating the TNF-alpha mRNA half-life.

AA Sequence

MSSEPPPPPQPPTHQASVGLLDTPRSRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKGVCKCF      1 - 70
CRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETW     71 - 140
SGHVISS                                                                   141 - 147
//

Text Mined References (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21990353 2011 Inhibition of gluconeogenic genes by calcium-regulated heat-stable protein 1 via repression of peroxisome proliferator-activated receptor ?.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21177848 2011 Structure-functional analyses of CRHSP-24 plasticity and dynamics in oxidative stress response.
21078874 2011 CARHSP1 is required for effective tumor necrosis factor alpha mRNA stabilization and localizes to processing bodies and exosomes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...