Property Summary

NCBI Gene PubMed Count 19
PubMed Score 3.37
PubTator Score 4.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis 1.300 6.8e-04
glioblastoma 1.100 2.8e-03
group 3 medulloblastoma 1.400 3.0e-04
osteosarcoma -1.764 1.8e-05
primitive neuroectodermal tumor 1.200 3.6e-03
psoriasis 2.400 7.1e-11

Gene RIF (4)

AA Sequence

MSSEPPPPPQPPTHQASVGLLDTPRSRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKGVCKCF      1 - 70
CRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETW     71 - 140
SGHVISS                                                                   141 - 147
//

Text Mined References (29)

PMID Year Title