Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.74
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.100 1.8e-03
lung carcinoma 2.800 1.3e-39
medulloblastoma, large-cell 1.200 2.0e-03
primitive neuroectodermal tumor 1.100 2.0e-02

 Compartment GO Term (1)

Gene RIF (3)

AA Sequence

MILTKAQYDEIAQCLVSVPPTRQSLRKLKQRFPSQSQATLLSIFSQEYQKHIKRTHAKHHTSEAIESYYQ      1 - 70
RYLNGVVKNGAAPVLLDLANEVDYAPSLMARLILERFLQEHEETPPSKSIINSMLRDPSQIPDGVLANQV     71 - 140
YQCIVNDCCYGPLVDCIKHAIGHEHEVLLRDLLLEKNLSFLDEDQLRAKGYDKTPDFILQVPVAVEGHII    141 - 210
HWIESKASFGDECSHHAYLHDQFWSYWNRFGPGLVIYWYGFIQELDCNRERGILLKACFPTNIVTLCHSI    211 - 280
A//

Text Mined References (12)

PMID Year Title