Property Summary

NCBI Gene PubMed Count 24
PubMed Score 0.00
PubTator Score 11.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.120 0.000
pancreatic ductal adenocarcinoma liver m... -1.295 0.003
lung cancer 1.200 0.023
ovarian cancer 1.300 0.000

Gene RIF (11)

PMID Text
26984527 findings establish that PolDIP2 can regulate the translesion synthesis polymerase and primer extension activities of PrimPol
25930997 POLDIP2 plays a crucial role in Tau aggregation via the impairment of autophagy activity, providing insight into Tau aggregation in Tau pathology.
24191025 DNA polymerase delta-interacting protein 2 is a processivity factor for DNA polymerase lambda during 8-oxo-7,8-dihydroguanine bypass.
23989611 PDIP38 can respond to genotoxic or transcriptional stresses by undergoing translocation to the spliceosomes, where it is a required participant in the regulation of MDM2 alternative splicing.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20554254 We demonstrate that PDIP38 (Poldelta interacting protein of 38kDa) directly interacts with the TLS polymerase Poleta. PDIP38 is able to interact directly not only with Poleta but also with the specialized polymerases Rev1 and Polzeta (via Rev7).
20158880 suggest that the TNFAIP1/POLDIP2 complex sense-antisense architecture represents a clinically significant transcriptional structural-functional gene module associated with amplification of the genomic region on 17q11.2 in breast cancer.
19574552 Poldip2 associates with p22phox to activate Nox4, leading to regulation of focal adhesion turnover and vascular smooth muscle cell migration, thus linking reactive oxygen species production and cytoskeletal remodeling.
17623671 PDIP38 can shuttle between the cytoplasmic and the nuclear compartments and that its subcellular localization is regulated by CEACAM1
16428295 PDIP38 is located in the mitochondrial matrix. TFAM and mitochondrial single-stranded DNA binding protein (mtSSB) are co-immunoprecipitated with PDIP38
More...

AA Sequence

MAACTARRALAVGSRWWSRSLTGARWPRPLCAAAGAGAFSPASTTTTRRHLSSRNRPEGKVLETVGVFEV      1 - 70
PKQNGKYETGQLFLHSIFGYRGVVLFPWQARLYDRDVASAAPEKAENPAGHGSKEVKGKTHTYYQVLIDA     71 - 140
RDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPP    141 - 210
FVARETLRAWQEKNHPWLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLR    211 - 280
ERHWRIFSLSGTLETVRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPP    281 - 350
FSLESNKDEKTPPSGLHW                                                        351 - 368
//

Text Mined References (29)

PMID Year Title
26984527 2016 PolDIP2 interacts with human PrimPol and enhances its DNA polymerase activities.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25930997 2015 Essential role of POLDIP2 in Tau aggregation and neurotoxicity via autophagy/proteasome inhibition.
25416956 2014 A proteome-scale map of the human interactome network.
25080503 2014 Meta-analysis of genome-wide association studies identifies two loci associated with circulating osteoprotegerin levels.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24191025 2013 DNA polymerase ?-interacting protein 2 is a processivity factor for DNA polymerase ? during 8-oxo-7,8-dihydroguanine bypass.
23989611 2013 PDIP38 is translocated to the spliceosomes/nuclear speckles in response to UV-induced DNA damage and is required for UV-induced alternative splicing of MDM2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...