Property Summary

NCBI Gene PubMed Count 13
Grant Count 2
Funding $139,500
PubMed Score 8.88
PubTator Score 6.88

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y2R0 A8K498
Symbols COX25
CCDC56
HSPC009
MITRAC12

Gene

 Grant Application (2)

Gene RIF (5)

PMID Text
26358295 Data show that mitochondrial protein ccdc56/MITRAC12/COA3 positively regulates mitochondrial fission by recruiting the fission factor Drp1.
25604084 COX14 was undetectable in COA3 subject fibroblasts, and that COA3 was undetectable in fibroblasts from a COX14 subject, demonstrating the interdependence of these two COX assembly factors
23362268 hCOA3 stabilizes COX1 co-translationally and promotes its assembly with COX partner subunits.
23260140 Study comprehensively identified mammalian cytochrome c oxidase assembly factors. These analyses led to the discoveryof MITRAC12, which defines the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase)complexes.
22356826 Human ortholog of fungal COA3 (Cytochrome oxidase assembly)

AA Sequence

MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLA      1 - 70
IYGYTFYSISQERFLDELEDEAKAARARALARASGS                                       71 - 106
//

Text Mined References (19)

PMID Year Title
26358295 2015 COX assembly factor ccdc56 regulates mitochondrial morphology by affecting mitochondrial recruitment of Drp1.
26321642 2015 MITRAC7 Acts as a COX1-Specific Chaperone and Reveals a Checkpoint during Cytochrome c Oxidase Assembly.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25604084 2015 Mutations in COA3 cause isolated complex IV deficiency associated with neuropathy, exercise intolerance, obesity, and short stature.
23362268 2013 hCOA3 stabilizes cytochrome c oxidase 1 (COX1) and promotes cytochrome c oxidase assembly in human mitochondria.
23260140 2012 MITRAC links mitochondrial protein translocation to respiratory-chain assembly and translational regulation.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22610097 2012 Coiled coil domain-containing protein 56 (CCDC56) is a novel mitochondrial protein essential for cytochrome c oxidase function.
22356826 2012 Iterative orthology prediction uncovers new mitochondrial proteins and identifies C12orf62 as the human ortholog of COX14, a protein involved in the assembly of cytochrome c oxidase.
21269460 2011 Initial characterization of the human central proteome.
More...