Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.16
PubTator Score 6.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (6)

AA Sequence

MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLA      1 - 70
IYGYTFYSISQERFLDELEDEAKAARARALARASGS                                       71 - 106
//

Text Mined References (20)

PMID Year Title