Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.78
PubTator Score 7.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.300 2.3e-19
non primary Sjogren syndrome sicca 1.100 1.9e-02
osteosarcoma -1.164 1.2e-03
pancreatic ductal adenocarcinoma liver m... -1.125 3.5e-03
tuberculosis 1.200 6.0e-07

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLK      1 - 70
FILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS                    71 - 125
//

Text Mined References (22)

PMID Year Title