Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.78
PubTator Score 7.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.300 2.3e-19
non primary Sjogren syndrome sicca 1.100 1.9e-02
osteosarcoma -1.164 1.2e-03
pancreatic ductal adenocarcinoma liver m... -1.125 3.5e-03
tuberculosis 1.200 6.0e-07

Synonym

Accession Q9Y2Q5 Q5VY97 Q5VY98 Q5VY99
Symbols p14
ENDAP
ROBLD3
HSPC003
MAPBPIP
MAPKSP1AP
Ragulator2

Gene

PDB

6B9X   6EHP   6EHR  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLK      1 - 70
FILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS                    71 - 125
//

Text Mined References (22)

PMID Year Title