Property Summary

NCBI Gene PubMed Count 32
PubMed Score 313.86
PubTator Score 111.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung carcinoma 413 2.35786989556231E-30
lung adenocarcinoma 2714 7.48705910821033E-11
ovarian cancer 8492 1.21959359938448E-10
malignant mesothelioma 3163 2.30821694315414E-10
pituitary cancer 1972 6.37646987099891E-7
lung cancer 4473 1.83002585672777E-6
atypical teratoid / rhabdoid tumor 4369 5.54117108928276E-6
medulloblastoma, large-cell 6234 8.18700636893285E-5
glioblastoma 5572 1.14454046933063E-4
ductal carcinoma in situ 1745 3.57654595221732E-4
Pick disease 1893 3.89579448689361E-4
psoriasis 6685 6.17844841409978E-4
medulloblastoma 1524 0.00193294424386527
invasive ductal carcinoma 2950 0.00213536187738299
interstitial cystitis 2299 0.00645165784580466
ependymoma 2514 0.00813513432851302
colon cancer 1475 0.0124688749224963
adult high grade glioma 2148 0.0136177893480558
Breast cancer 3099 0.0215258560780546
astrocytic glioma 2241 0.0288094005865942
oligodendroglioma 2849 0.0325114707466816
osteosarcoma 7933 0.0463425421202964
Alzheimer's disease 644 0.0494580996319824
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Shigellosis 16 3.597 1.8
Extratemporal epilepsy 6 3.434 1.7

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma 6.600 0.000
astrocytic glioma 1.500 0.029
oligodendroglioma 1.700 0.033
psoriasis -2.200 0.001
osteosarcoma 1.404 0.046
ependymoma 1.600 0.008
glioblastoma 2.300 0.000
medulloblastoma -2.000 0.002
atypical teratoid / rhabdoid tumor 3.200 0.000
medulloblastoma, large-cell 3.000 0.000
non-small cell lung carcinoma -1.300 0.000
colon cancer -3.600 0.012
lung cancer -5.500 0.000
Breast cancer -4.400 0.022
interstitial cystitis -1.300 0.006
adult high grade glioma 1.800 0.014
lung adenocarcinoma -2.100 0.000
Alzheimer's disease 1.300 0.049
Pick disease 2.500 0.000
ductal carcinoma in situ -1.500 0.000
invasive ductal carcinoma -1.700 0.002
ovarian cancer 1.700 0.000
pituitary cancer -3.400 0.000

Synonym

Accession Q9Y2N7 B0M185 B4DNA2 I6L988 Q58A43 Q66K72 Q8WXA1 Q96K34 Q9H7Z9 Q9HAI2 HIF-3-alpha
Symbols IPAS
MOP7
PASD7
HIF-3A
bHLHe17
HIF3-alpha-1

Gene

PDB

4WN5  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (22)

PMID Text
26717317 HIF3A DNA Methylation Is Associated with Childhood Obesity and ALT
26237540 Unsaturated fatty acids are high-affinity ligands of the C-terminal domain from the HIF-3alpha.
26174816 inverse association with hypertrophic markers in chondrogenic cells
26011824 The association between increased DNA methylation at HIF3A and increased adiposity is present in neonates.
26001398 A DNA methylation variant in HIF3A was associated with BMI changes through interactions with total or supplemental vitamin B2, vitamin B12, and folate.
25936862 HIF3alpha has a transcriptional regulatory function, which negatively affects gene expression by competing with HIF1alpha and HIF2alpha in binding to transcriptional elements in target genes during hypoxia. (Review)
24927770 Here we provide evidence for the miRNA mediated regulation of HIF3a by hypoxia responsive miRNAs in STS, which may help to tightly regulate and fine-tune the hypoxic response.
24371328 These findings highlight the importance of the hypoxia-sensing pathway and HIFs in clinical hematology.
24092767 The Inhibitory Per/Arnt/Sim (PAS) domain protein (IPAS) is a splice variant of hypoxia-inducible factor (HIF)-3alpha, and possesses two entirely different functions. The results strongly suggest that IPAS is a nucleocytoplasmic shuttling protein.
23485455 the transcription of HIF-3alpha4 was silenced by the promoter DNA methylation in meningiomas, and inducible HIF-3alpha4 impaired angiogenesis, proliferation, and metabolism/oxidation in hypervascular meningiomas
More...

AA Sequence

MALGLQRARSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLTISYLRMHRLC      1 - 70
AAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLSQLELIGHSIFDFIHPCDQEE     71 - 140
LQDALTPQQTLSRRKVEAPTERCFSLRMKSTLTSRGRTLNLKAATWKVLNCSGHMRAYKPPAQTSPAGSP    141 - 210
DSEPPLQCLVLICEAIPHPGSLEPPLGRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHA    211 - 280
LDSDAVSKSIHTLLSKGQAVTGQYRFLARSGGYLWTQTQATVVSGGRGPQSESIVCVHFLISQVEETGVV    281 - 350
LSLEQTEQHSRRPIQRGAPSQKDTPNPGDSLDTPGPRILAFLHPPSLSEAALAADPRRFCSPDLRRLLGP    351 - 420
ILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALDLEML    421 - 490
APYISMDDDFQLNASEQLPRAYHRPLGAVPRPRARSFHGLSPPALEPSLLPRWGSDPRLSCSSPSRGDPS    491 - 560
ASSPMAGARKRTLAQSSEDEDEGVELLGVRPPKRSPSPEHENFLLFPLSLSFLLTGGPAPGSLQDPSTPL    561 - 630
LNLNEPLGLGPSLLSPYSDEDTTQPGGPFQPRAGSAQAD                                   631 - 669
//

Text Mined References (34)

PMID Year Title
26717317 2015 HIF3A DNA Methylation Is Associated with Childhood Obesity and ALT.
26237540 2015 Unsaturated fatty acids as high-affinity ligands of the C-terminal Per-ARNT-Sim domain from the Hypoxia-inducible factor 3?.
26174816 2015 Hypoxia-inducible factor 3-alpha expression is associated with the stable chondrocyte phenotype.
26011824 2015 HIF3A association with adiposity: the story begins before birth.
26001398 2015 DNA Methylation Variants at HIF3A Locus, B-Vitamin Intake, and Long-term Weight Change: Gene-Diet Interactions in Two U.S. Cohorts.
25936862 2015 Progress on hypoxia-inducible factor-3: Its structure, gene regulation and biological function (Review).
24927770 2014 MicroRNA response to hypoxic stress in soft tissue sarcoma cells: microRNA mediated regulation of HIF3?.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24371328 2014 Targeting the hypoxia-sensing pathway in clinical hematology.
24092767 2013 Nucleocytoplasmic shuttling of IPAS by its unique nuclear import and export signals unshared with other HIF-3? splice variants.
More...