Property Summary

NCBI Gene PubMed Count 42
PubMed Score 341.78
PubTator Score 111.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -1.700 2.5e-03
Alzheimer's disease 1.300 4.9e-02
astrocytic glioma 1.500 2.9e-02
atypical teratoid / rhabdoid tumor 1.300 1.7e-02
Breast cancer -4.400 2.2e-02
colon cancer -3.600 1.2e-02
ductal carcinoma in situ -1.200 1.3e-04
ependymoma 1.600 8.1e-03
glioblastoma -1.100 1.3e-02
group 4 medulloblastoma -1.900 7.4e-04
interstitial cystitis -1.300 6.5e-03
invasive ductal carcinoma -1.200 7.9e-04
lung adenocarcinoma -2.100 7.5e-11
lung cancer -1.300 4.7e-03
malignant mesothelioma 4.300 2.7e-07
medulloblastoma, large-cell -2.600 8.7e-06
non-small cell lung cancer -1.197 6.6e-09
oligodendroglioma 1.700 3.3e-02
osteosarcoma 1.404 4.6e-02
ovarian cancer 1.100 4.6e-08
Pick disease 2.500 3.9e-04
pituitary cancer -3.100 3.1e-06
psoriasis -1.300 2.1e-03

Protein-protein Interaction (1)

Gene RIF (32)

AA Sequence

MALGLQRARSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLTISYLRMHRLC      1 - 70
AAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLSQLELIGHSIFDFIHPCDQEE     71 - 140
LQDALTPQQTLSRRKVEAPTERCFSLRMKSTLTSRGRTLNLKAATWKVLNCSGHMRAYKPPAQTSPAGSP    141 - 210
DSEPPLQCLVLICEAIPHPGSLEPPLGRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHA    211 - 280
LDSDAVSKSIHTLLSKGQAVTGQYRFLARSGGYLWTQTQATVVSGGRGPQSESIVCVHFLISQVEETGVV    281 - 350
LSLEQTEQHSRRPIQRGAPSQKDTPNPGDSLDTPGPRILAFLHPPSLSEAALAADPRRFCSPDLRRLLGP    351 - 420
ILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALDLEML    421 - 490
APYISMDDDFQLNASEQLPRAYHRPLGAVPRPRARSFHGLSPPALEPSLLPRWGSDPRLSCSSPSRGDPS    491 - 560
ASSPMAGARKRTLAQSSEDEDEGVELLGVRPPKRSPSPEHENFLLFPLSLSFLLTGGPAPGSLQDPSTPL    561 - 630
LNLNEPLGLGPSLLSPYSDEDTTQPGGPFQPRAGSAQAD                                   631 - 669
//

Text Mined References (44)

PMID Year Title