Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.77
PubTator Score 7.07

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y2M5 B3KMA0 B4DUR0 Q5TZF2 Q5ZF45 Q9H457
Symbols KHLHX
KLEIP
KLHLX

Gene

Gene RIF (6)

PMID Text
26687681 Study identifies a key role of Cul3-KLHL20 in autophagy termination by controlling autophagy-dependent turnover of ULK1 and VPS34 complex subunits and reveals the pathophysiological functions of this autophagy termination mechanism.
24768539 study reveals a function of KLHL20-mediated, K33-linked ubiquitination of Crn7 in the assembly of (trans-Golgi network )TGN-associated F-actin to promote post-Golgi trafficking and identifies a cellular decoding mechanism for this ubiquitin chain type.
21888897 These results indicate that KLHL20 is a novel player that regulates HIF-2alpha protein expression through mechanisms independent of hypoxia and pVHL.
21840486 study indicates that the KLHL20-mediated PML degradation and HIF-1alpha autoregulation play key roles in tumor progression
20389280 KLHL20-Cul3-ROC1 is an E3 ligase for DAPK ubiquitination
17395875 BTB-kelch protein KLEIP, a novel regulator of endothelial function during angiogenesis, controls the vascular endothelial growth factor (VEGF)-induced activation of Rho GTPases.

AA Sequence

MEGKPMRRCTNIRPGETGMDVTSRCTLGDPNKLPEGVPQPARMPYISDKHPRQTLEVINLLRKHRELCDV      1 - 70
VLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQITVEEGNVQT     71 - 140
LLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFMLLP    141 - 210
ANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSD    211 - 280
EECRDLVDEAKNYLLLPQERPLMQGPRTRPRKPIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVAS    281 - 350
MSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGFLYAVGG    351 - 420
QDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTI    421 - 490
APMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVG    491 - 560
GFDGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGVGVIKMTHCESHIW                         561 - 609
//

Text Mined References (19)

PMID Year Title
26687681 2016 Cul3-KLHL20 Ubiquitin Ligase Governs the Turnover of ULK1 and VPS34 Complexes to Control Autophagy Termination.
24768539 2014 K33-Linked Polyubiquitination of Coronin 7 by Cul3-KLHL20 Ubiquitin E3 Ligase Regulates Protein Trafficking.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
21888897 2011 Kelch-like 20 up-regulates the expression of hypoxia-inducible factor-2? through hypoxia- and von Hippel-Lindau tumor suppressor protein-independent regulatory mechanisms.
21840486 2011 A Cullin3-KLHL20 Ubiquitin ligase-dependent pathway targets PML to potentiate HIF-1 signaling and prostate cancer progression.
21670212 2011 PDZ-RhoGEF ubiquitination by Cullin3-KLHL20 controls neurotrophin-induced neurite outgrowth.
20389280 2010 The Cullin 3 substrate adaptor KLHL20 mediates DAPK ubiquitination to control interferon responses.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17395875 2007 The BTB-Kelch protein KLEIP controls endothelial migration and sprouting angiogenesis.
More...