Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.16
PubTator Score 3.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.300 4.8e-03
astrocytic glioma -1.500 3.0e-03
Astrocytoma, Pilocytic -1.600 2.3e-06
atypical teratoid / rhabdoid tumor -1.900 4.2e-12
glioblastoma -1.800 3.9e-07
group 3 medulloblastoma -2.000 1.0e-03
lung carcinoma 5.700 6.9e-65
medulloblastoma, large-cell -1.500 7.4e-05
non primary Sjogren syndrome sicca -1.100 1.9e-02
oligodendroglioma -1.100 2.7e-02
pituitary cancer 1.100 3.9e-04
primitive neuroectodermal tumor -1.600 1.9e-05
psoriasis -1.900 1.5e-19

Gene RIF (5)

AA Sequence

MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSEYFQICKTVRHGFP      1 - 70
HQPTALAFDPVQKILAIGTRTGAIRILGRPGVDCYCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNL     71 - 140
RQKRPAILHSLKFNRERITYCHLPFQSKWLYVGTERGNTHIVNIESFILSGYVIMWNKAIELSTKTHPGP    141 - 210
VVHLSDSPRDEGKLLIGYENGTVVFWDLKSKRAELRVYYDEAIHSIDWHHEGKQFMCSHSDGSLTLWNLK    211 - 280
SPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSYDKACRRPSLTIMHGKAITV    281 - 350
LEMDHPIVEFLTLCETPYPNEFQEPYAVVVLLEKDLIVVDLTQSNFPIFENPYPMDIHESPVTCTAYFAD    351 - 420
CPPDLILVLYSIGVKHKKQGYSNKEWPISGGAWNLGAQTYPEIIITGHADGSIKFWDASAITLQMLYKLK    421 - 490
TSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSAYVIIYKFSRHEITTEIVSLEVRLQ    491 - 560
YDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGYQAELVIQ    561 - 630
LVWVDGEPPQQITSLAVSSAYGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLYRSSDLYQRQPRSPRKNKQ    631 - 700
FIADNFCMRGLSNFYPDLTKRIRTSYQSLTELNDSPVPLELERCKSPTSDHVNGHCTSPTSQSCSSGKRL    701 - 770
SSADVSKVNRWGPGRPPFRKAQSAACMEISLPVTTEENRENSYNRSRSSSISSIDKDSKEAITALYFMDS    771 - 840
FARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSGTFLSLKGAVLTFSCMDRMGGLMQ    841 - 910
PPYEVWRDPNNIDENEKSWRRKVVMNSSSASQEIGDHQYTIICSEKQAKVFSLPSQTCLYVHNITETSFI    911 - 980
LQANVVVMCSSACLACFCANGHIMIMSLPSLRPMLDVNYLPLTDMRIARTFCFTNEGQALYLVSPTEIQR    981 - 1050
LTYSQEMCDNLQDMLGDLFTPIETPEAQNRGFLKGLFGGSGQTFDREELFGEASAGKASRSLAQHIPGPG   1051 - 1120
SIEGMKGAAGGVMGELTRARIALDERGQRLGELEEKTAGMMTSAEAFSKHAHELMLKYKDKKWYQF       1121 - 1186
//

Text Mined References (11)

PMID Year Title