Property Summary

NCBI Gene PubMed Count 22
PubMed Score 11.09
PubTator Score 9.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.2829800946128E-22
ovarian cancer 8492 2.47060146349851E-5
osteosarcoma 7933 6.39058480748813E-5
medulloblastoma, large-cell 6234 4.25398943896455E-4

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.444 0.000
medulloblastoma, large-cell -1.100 0.000
lung carcinoma 1.100 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q9Y2K6 Q541F1 Q8IXQ1 Q96LG5 Q9UQN8 Q9UQP0
Symbols VDU2
hVDU2
LSFR3A

Gene

  Ortholog (12)

 IMPC Term (1)

Gene RIF (12)

PMID Text
25708858 we investigated the inter-action between PKM2 and USP20. Our results suggest a new molecular pathway in cancer metabolism through the regulation of PKM2.
25666616 findings reveal a dynamic regulation of USP20 by site-specific phosphorylation as well as the interdependence of signal transduction and trafficking pathways in balancing adrenergic stimulation and maintaining cellular homeostasis
24923443 data establish a new function of USP20 in genome maintenance and DNA repair.
23166591 Expression of HIV-1 Tat downregulates the abundance of ubiquitin specific peptidase 20 (USP20) in the nucleoli of Jurkat T-cells
22552337 Analysis of indel variations in the human disease-associated genes CDKN2AIP, WDR66, USP20 and OR7C2 in a Korean population.
21525354 Our results point to USP20 as a key negative regulator of HTLV-1 Tax-induced NF-kappaB signaling.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19424180 USPs 20 and 33 serve as novel regulators that dictate both post-endocytic sorting as well as the intensity and extent of beta(2)AR signalling from the cell surface.
18976975 Knockdown of ubiquitin specific peptidase 20 (USP20) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
More...

AA Sequence

MGDSRDLCPHLDSIGEVTKEDLLLKSKGTCQSCGVTGPNLWACLQVACPYVGCGESFADHSTIHAQAKKH      1 - 70
NLTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLK     71 - 140
PRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVP    141 - 210
TSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSE    211 - 280
DEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADV    281 - 350
DTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPS    351 - 420
YVLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHS    421 - 490
AIYQNVPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSC    491 - 560
ERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLDLRPFLAKECTSQITTYDLL    561 - 630
SVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLA    631 - 700
AMREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGG    701 - 770
GPAVNHLYVCSICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPP    771 - 840
GPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYGGGPEIAIRQSVAQPLGPENLHGEQKIEAE    841 - 910
TRAV                                                                      911 - 914
//

Text Mined References (29)

PMID Year Title
25708858 2015 Regulation of pyruvate kinase isozyme M2 is mediated by the ubiquitin-specific protease 20.
25666616 2015 Phosphorylation of the deubiquitinase USP20 by protein kinase A regulates post-endocytic trafficking of ?2 adrenergic receptors to autophagosomes during physiological stress.
25416956 2014 A proteome-scale map of the human interactome network.
24923443 2014 Ubiquitin-specific peptidase 20 regulates Rad17 stability, checkpoint kinase 1 phosphorylation and DNA repair by homologous recombination.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23486064 2013 USP33 regulates centrosome biogenesis via deubiquitination of the centriolar protein CP110.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22552337 2012 Analysis of indel variations in the human disease-associated genes CDKN2AIP, WDR66, USP20 and OR7C2 in a Korean population.
21525354 2011 Ubiquitin-specific peptidase 20 targets TRAF6 and human T cell leukemia virus type 1 tax to negatively regulate NF-kappaB signaling.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...