Property Summary

NCBI Gene PubMed Count 22
Grant Count 12
R01 Count 8
Funding $887,000.13
PubMed Score 11.09
PubTator Score 9.98

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.444 0.000
medulloblastoma, large-cell -1.100 0.000
lung carcinoma 1.100 0.000
ovarian cancer 1.200 0.000

Gene RIF (12)

PMID Text
25708858 we investigated the inter-action between PKM2 and USP20. Our results suggest a new molecular pathway in cancer metabolism through the regulation of PKM2.
25666616 findings reveal a dynamic regulation of USP20 by site-specific phosphorylation as well as the interdependence of signal transduction and trafficking pathways in balancing adrenergic stimulation and maintaining cellular homeostasis
24923443 data establish a new function of USP20 in genome maintenance and DNA repair.
23166591 Expression of HIV-1 Tat downregulates the abundance of ubiquitin specific peptidase 20 (USP20) in the nucleoli of Jurkat T-cells
22552337 Analysis of indel variations in the human disease-associated genes CDKN2AIP, WDR66, USP20 and OR7C2 in a Korean population.
21525354 Our results point to USP20 as a key negative regulator of HTLV-1 Tax-induced NF-kappaB signaling.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19424180 USPs 20 and 33 serve as novel regulators that dictate both post-endocytic sorting as well as the intensity and extent of beta(2)AR signalling from the cell surface.
18976975 Knockdown of ubiquitin specific peptidase 20 (USP20) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
More...

AA Sequence

MGDSRDLCPHLDSIGEVTKEDLLLKSKGTCQSCGVTGPNLWACLQVACPYVGCGESFADHSTIHAQAKKH      1 - 70
NLTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLK     71 - 140
PRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVP    141 - 210
TSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSE    211 - 280
DEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADV    281 - 350
DTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPS    351 - 420
YVLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHS    421 - 490
AIYQNVPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSC    491 - 560
ERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLDLRPFLAKECTSQITTYDLL    561 - 630
SVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLA    631 - 700
AMREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGG    701 - 770
GPAVNHLYVCSICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPP    771 - 840
GPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYGGGPEIAIRQSVAQPLGPENLHGEQKIEAE    841 - 910
TRAV                                                                      911 - 914
//

Text Mined References (29)

PMID Year Title
25708858 2015 Regulation of pyruvate kinase isozyme M2 is mediated by the ubiquitin-specific protease 20.
25666616 2015 Phosphorylation of the deubiquitinase USP20 by protein kinase A regulates post-endocytic trafficking of ?2 adrenergic receptors to autophagosomes during physiological stress.
25416956 2014 A proteome-scale map of the human interactome network.
24923443 2014 Ubiquitin-specific peptidase 20 regulates Rad17 stability, checkpoint kinase 1 phosphorylation and DNA repair by homologous recombination.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23486064 2013 USP33 regulates centrosome biogenesis via deubiquitination of the centriolar protein CP110.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22552337 2012 Analysis of indel variations in the human disease-associated genes CDKN2AIP, WDR66, USP20 and OR7C2 in a Korean population.
21525354 2011 Ubiquitin-specific peptidase 20 targets TRAF6 and human T cell leukemia virus type 1 tax to negatively regulate NF-kappaB signaling.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...