Property Summary

Ligand Count 3
NCBI Gene PubMed Count 50
PubMed Score 164.20
PubTator Score 115.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease -1.724 3.0e-03
active ulcerative colitis -2.017 7.4e-03
atypical teratoid / rhabdoid tumor -1.800 1.2e-04
Breast cancer -1.500 7.3e-05
colon cancer -1.700 9.2e-03
ependymoma -1.100 4.3e-03
group 3 medulloblastoma -2.300 3.5e-02
lung cancer -3.100 2.2e-05
medulloblastoma, large-cell -2.200 3.4e-05
osteosarcoma -3.572 4.2e-06
pancreatic cancer 1.100 3.8e-03
pancreatic carcinoma 1.100 3.8e-03
primitive neuroectodermal tumor -1.900 3.2e-03
psoriasis -1.200 1.1e-06
tuberculosis 1.100 5.6e-03

Synonym

Accession Q9Y2J8 Q96DA7 Q9UPN2
Symbols PAD2
PDI2
PAD-H19

Gene

PDB

4N20   4N22   4N24   4N25   4N26   4N28   4N2A   4N2B   4N2C   4N2D   4N2E   4N2F   4N2G   4N2H   4N2I   4N2K   4N2L   4N2M   4N2N  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (38)

AA Sequence

MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWL      1 - 70
LSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASW     71 - 140
TWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSD    141 - 210
KVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDI    211 - 280
PLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQ    281 - 350
DEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVN    351 - 420
GKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVPIPGTKKFLLL    421 - 490
MASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQENLYFQRCLDWNRDILKKELG    491 - 560
LTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDLGIPKPFGPQVEEECCLEMHVRGLLEPLGLECT    561 - 630
FIDDISAYHKFLGEVHCGTNVRRKPFTFKWWHMVP                                       631 - 665
//

Text Mined References (51)

PMID Year Title