Property Summary

NCBI Gene PubMed Count 43
Grant Count 17
R01 Count 10
Funding $929,806.15
PubMed Score 147.67
PubTator Score 115.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer 1.100 0.004
psoriasis -3.800 0.000
osteosarcoma -3.572 0.000
ependymoma -1.100 0.004
sonic hedgehog group medulloblastoma -2.800 0.000
atypical teratoid/rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor -1.900 0.003
tuberculosis 1.100 0.006
colon cancer -2.800 0.004
lung cancer -4.600 0.000
active Crohn's disease -1.724 0.003
ulcerative colitis -3.500 0.000
pancreatic carcinoma 1.100 0.004
Breast cancer -1.500 0.000

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
588438 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 1 against PAD1-4
588462 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of streptonigrin against PAD1-3
588471 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 3 against PAD1-4
588472 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 14 against PAD1-4
588484 confirmatory 0 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 10 against PAD1-4
588486 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 21 against PAD1-4
588487 other 35 / 0 / 44 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): fluorescence-based biochemical gel-based competitive Activity-Based Protein Profiling (ABPP) inhibition by HTS hits of PADs 1-4
588488 other 0 / 0 / 34 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of HTS hits against PAD1-4
588490 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 17 against PAD1-4
588560 other 12 / 0 / 18 Late stage assay provider results from the probe development effort to identify inhibitors of PAD4: colorimetric biochemical substrate assay to identify inhibitors of PADs 1-4
More...

Gene RIF (31)

PMID Text
26255191 We identified the presence of PADI3 mRNA expression in synovial tissue and PADI2 and PADI4 mRNA expressions in fibroblast-like synoviocytes from patients with rheumatoid arthritis.
26245941 PAD2 activity was significantly higher in cell-free synovial fluid of rheumatoid arthritis patients compared to osteoarthritis patients.
25897949 Report increased levels of extracellular PAD2 in the lungs of smokers.
25621824 Protein arginine deiminase 2 binds six calcium ions in an ordered fashion.
25475141 PAD2 activity was detected in synovial fluid samples from patients with rheumatoid arthritis.
25213324 these studies provide the first genetic evidence that PAD2 functions as an oncogene and suggest that PAD2 may promote tumor progression by enhancing inflammation within the tumor microenvironment.
24989433 PAD2 appears to use a substrate-assisted mechanism of catalysis in which the positively charged substrate guanidinium depresses the pKa of the nucleophilic cysteine
24850148 PADI2 and vimentin participate in the apoptotic mechanisms of activated T lymphocytes.
24594197 PAD2 and PAD4 have distinct substrate specificities.
24384061 Data suggest peptidylarginine deiminase 2 (PAD2) as a possible biomarker in various inflammatory diseases.
More...

AA Sequence

MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWL      1 - 70
LSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASW     71 - 140
TWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSD    141 - 210
KVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDI    211 - 280
PLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQ    281 - 350
DEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVN    351 - 420
GKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVPIPGTKKFLLL    421 - 490
MASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQENLYFQRCLDWNRDILKKELG    491 - 560
LTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDLGIPKPFGPQVEEECCLEMHVRGLLEPLGLECT    561 - 630
FIDDISAYHKFLGEVHCGTNVRRKPFTFKWWHMVP                                       631 - 665
//

Text Mined References (44)

PMID Year Title
26255191 2016 The amount of citrullinated proteins in synovial tissue is related to serum anti-cyclic citrullinated peptide (anti-CCP) antibody levels.
26245941 2015 Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid.
25897949 Smoking is associated with increased levels of extracellular peptidylarginine deiminase 2 (PAD2) in the lungs.
25621824 2015 Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
25475141 2014 Demonstration of extracellular peptidylarginine deiminase (PAD) activity in synovial fluid of patients with rheumatoid arthritis using a novel assay for citrullination of fibrinogen.
25213324 2014 PAD2 overexpression in transgenic mice promotes spontaneous skin neoplasia.
24989433 2014 Mechanistic studies of protein arginine deiminase 2: evidence for a substrate-assisted mechanism.
24850148 2014 Vimentin is involved in peptidylarginine deiminase 2-induced apoptosis of activated Jurkat cells.
24594197 2014 The human peptidylarginine deiminases type 2 and type 4 have distinct substrate specificities.
24384061 2014 Generation of monoclonal antibodies against peptidylarginine deiminase 2 (PAD2) and development of a PAD2-specific enzyme-linked immunosorbent assay.
More...