Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.39
PubTator Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.1e-07
malignant mesothelioma 3232 7.2e-07
osteosarcoma 7950 2.1e-05
medulloblastoma, large-cell 6241 3.2e-05
Pick disease 1894 6.2e-05
adult high grade glioma 3801 1.2e-04
dermatomyositis 966 2.9e-04
psoriasis 6694 3.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
ENSP00000256078 30 0.0 0.5
Disease Target Count Z-score Confidence
Kidney disease 430 0.0 3.0

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.100 1.2e-04
dermatomyositis 1.300 2.9e-04
malignant mesothelioma -1.300 7.2e-07
medulloblastoma, large-cell -1.400 3.2e-05
osteosarcoma -1.356 2.1e-05
ovarian cancer -2.000 2.1e-07
Pick disease -1.200 6.2e-05
psoriasis 1.100 3.9e-03

Protein-protein Interaction (10)

Gene RIF (6)

AA Sequence

MPTESASCSTARQTKQKRKSHSLSIRRTNSSEQERTGLPRDMLEGQDSKLPSSVRSTLLELFGQIEREFE      1 - 70
NLYIENLELRREIDTLNERLAAEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYKASTSKIVSSFKTT     71 - 140
TSRAACQLVKEYIGHRDGIWDVSVAKTQPVVLGTASADHTALLWSIETGKCLVKYAGHVGSVNSIKFHPS    141 - 210
EQLALTASGDQTAHIWRYAVQLPTPQPVADTSISGEDEVECSDKDEPDLDGDVSSDCPTIRVPLTSLKSH    211 - 280
QGVVIASDWLVGGKQAVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPTQRLVVTSSRDTTFRLW    281 - 350
DFRDPSIHSVNVFQGHTDTVTSAVFTVGDNVVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQ    351 - 420
KIIALPHDNRQVRLFDMSGVRLARLPRSSRQGHRRMVCCSAWSEDHPVCNLFTCGFDRQAIGWNINIPAL    421 - 490
LQEK                                                                      491 - 494
//

Text Mined References (18)

PMID Year Title