Property Summary

NCBI Gene PubMed Count 54
Grant Count 76
R01 Count 60
Funding $7,097,711.34
PubMed Score 154.89
PubTator Score 80.25

Knowledge Summary

Patent (7,212)

Expression

Synonym

Accession Q9Y2I7 Q08AR7 Q08AR8 Q53ST3 Q53T36 Q8N5H0 Q8NB67 Phosphatidylinositol 3-phosphate 5-kinase
Symbols CFD
FAB1
HEL37
PIP5K
PIP5K3
ZFYVE29

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 GWAS Trait (1)

Gene RIF (36)

PMID Text
26405034 data identify a novel role of the ArPIKfyve-Sac3 complex in the mechanisms controlling aggregate formation of Sph1 and suggest that Sac3 protein deficiency or overproduction may facilitate aggregation of aggregation-prone proteins
26396486 A novel heterozygous frameshift mutation (c.3151dupA) and a copy number variations in PIKFYVE gene have been found in two unrelated Fleck corneal dystrophy patients.
26216398 The PIKfyve complex is required for APP trafficking, suggesting a feedback loop in which APP, by binding to and stimulating phosphatidylinositol-3,5-bisphosphate vesicle formation may control its own trafficking.
26125944 APP functionally cooperates with PIKfyve in vivo. This regulation is required for maintaining endosomal and neuronal function.
24840251 Data suggest PIKFYVE, MTMR3 (myotubularin related protein 3) and their product phosphatidylinositol 5-phosphate are involved in activation of RAC1 (rho family small GTP binding protein); this process regulates migration/invasion of carcinoma/sarcoma.
24600036 Data indicate that pharmacological or genetic inactivation of PIKfyve rapidly induces expression of the transcription repressor ATF3, which is necessary and sufficient for suppression of type I IFN expression.
23757022 Data indicate that AKT promotes EGFR recycling by phosphorylating and activating PIKfyve.
23297396 PIP5Kalpha promotes TLR4-associated microglial inflammation by mediating PIP(2)-dependent recruitment of TIRAP to the plasma membrane
23188060 the present observations show that PKB in conjunction with PIKfyve activates Kir2.1 channels.
23178941 Overexpression of phosphatidylinositol 4 phosphate 5-kinase (PIP5K) suppresses HIV-1 Tat-mediated inhibition of growth hormone secretion from cells
More...

AA Sequence

MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERAEGGQGEQQPL      1 - 70
SGSWTSPQLPSRTQSVRSPTPYKKQLNEELQRRSSALDTRRKAEPTFGGHDPRTAVQLRSLSTVLKRLKE     71 - 140
IMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTTFRRRHHCRLCGQIFCSRCCNQEIPGKFMGYTGDLRAC    141 - 210
TYCRKIALSYAHSTDSNSIGEDLNALSDSACSVSVLDPSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDS    211 - 280
SNTPLSTRLVSVQEDAGKSPARNRSASITNLSLDRSGSPMVPSYETSVSPQANRTYVRTETTEDERKILL    281 - 350
DSVQLKDLWKKICHHSSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWLD    351 - 420
CVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLAN    421 - 490
SASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKEYLISDTGGQQLSIS    491 - 560
DAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENGEKQAMERLLSANHNHMMALLQQLLHSDSLS    561 - 630
SSWRDIIVSLVCQVVQTVRPDVKNQDDDMDIRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMSSCIK    631 - 700
NPKILLLKCSIEYLYREETKFTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEHGIT    701 - 770
LVINVKSQVLERISRMTQGDLVMSMDQLLTKPHLGTCHKFYMQIFQLPNEQTKTLMFFEGCPQHLGCTIK    771 - 840
LRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLMQNPSFHSLIEGRGHEGAVQEQYGGGS    841 - 910
IPWDPDIPPESLPCDDSSLLELRIVFEKGEQENKNLPQAVASVKHQEHSTTACPAGLPCAFFAPVPESLL    911 - 980
PLPVDDQQDALGSEQPETLQQTVVLQDPKSQIRAFRDPLQDDTGLYVTEEVTSSEDKRKTYSLAFKQELK    981 - 1050
DVILCISPVITFREPFLLTEKGMRCSTRDYFAEQVYWSPLLNKEFKEMENRRKKQLLRDLSGLQGMNGSI   1051 - 1120
QAKSIQVLPSHELVSTRIAEHLGDSQSLGRMLADYRARGGRIQPKNSDPFAHSKDASSTSSGQSGSKNEG   1121 - 1190
DEERGLILSDAVWSTKVDCLNPINHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYGKNDLTLGIFLER   1191 - 1260
YCFRPSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQHTILTYSWCRICKQVTPVVALSN   1261 - 1330
ESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDYHQYFSYNQMVASFSYSPIRLLEVCVPLPKIFIK   1331 - 1400
RQAPLKVSLLQDLKDFFQKVSQVYVAIDERLASLKTDTFSKTREEKMEDIFAQKEMEEGEFKNWIEKMQA   1401 - 1470
RLMSSSVDTPQQLQSVFESLIAKKQSLCEVLQAWNNRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKISA   1471 - 1540
MDASPRNISPGLQNGEKEDRFLTTLSSQSSTSSTHLQLPTPPEVMSEQSVGGPPELDTASSSEDVFDGHL   1541 - 1610
LGSTDSQVKEKSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCEKEPSSIIAFALSCKEY   1611 - 1680
RNALEELSKATQWNSAEEGLPTNSTSDSRPKSSSPIRLPEMSGGQTNRTTETEPQPTKKASGMLSFFRGT   1681 - 1750
AGKSPDLSSQKRETLRGADSAYYQVGQTGKEGTENQGVEPQDEVDGGDTQKKQLINPHVELQFSDANAKF   1751 - 1820
YCRLYYAGEFHKMREVILDSSEEDFIRSLSHSSPWQARGGKSGAAFYATEDDRFILKQMPRLEVQSFLDF   1821 - 1890
APHYFNYITNAVQQKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRN   1891 - 1960
VKTDTGKESCDVVLLDENLLKMVRDNPLYIRSHSKAVLRTSIHSDSHFLSSHLIIDYSLLVGRDDTSNEL   1961 - 2030
VVGIIDYIRTFTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWTGLGLNC     2031 - 2098
//

Text Mined References (63)

PMID Year Title
26405034 2015 The Protein Complex of Neurodegeneration-related Phosphoinositide Phosphatase Sac3 and ArPIKfyve Binds the Lewy Body-associated Synphilin-1, Preventing Its Aggregation.
26396486 2015 Identification of novel PIKFYVE gene mutations associated with Fleck corneal dystrophy.
26216398 2016 APP controls the formation of PI(3,5)P(2) vesicles through its binding of the PIKfyve complex.
26125944 2015 The Amyloid Precursor Protein Controls PIKfyve Function.
25578879 2015 PI(5)P regulates autophagosome biogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
24840251 2014 PIKfyve, MTMR3 and their product PtdIns5P regulate cancer cell migration and invasion through activation of Rac1.
24600036 2014 PIKfyve, a class III lipid kinase, is required for TLR-induced type I IFN production via modulation of ATF3.
23757022 2013 AKT facilitates EGFR trafficking and degradation by phosphorylating and activating PIKfyve.
23297396 2013 Phosphatidylinositol 4-phosphate 5-kinase ? facilitates Toll-like receptor 4-mediated microglial inflammation through regulation of the Toll/interleukin-1 receptor domain-containing adaptor protein (TIRAP) location.
More...