Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.43
PubTator Score 3.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 5.04169571375622E-18
group 4 medulloblastoma 1875 3.55977800172473E-6
osteosarcoma 7933 5.43318021014914E-4
Disease Target Count Z-score Confidence
Oral squamous cell carcinoma 9 3.353 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.458 0.001
group 4 medulloblastoma 1.200 0.000
lung carcinoma 1.100 0.000

Synonym

Accession Q9Y2H8 Q5SZP5
Symbols

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (3)

PMID Text
21497587 Identifying 24-mer ZNF510 peptide as oral squamous cell carcinoma -related salivary biomarkers via proteomic approach proved useful in adjunct diagnosis for early detection rather than specific diagnosis marker for progression of OSCC patients
19030899 The present results suggest that the genomic region containing the ZNP510 and ZNP782 genes is an ethnic specific locus associated with stature variation in Chinese.
19030899 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MSPHPEAITDCVTLNTVGQLAEGGYPLRFSTLFQEQQKMNISQASVSFKDVTIEFTQEEWQQMAPVQKNL      1 - 70
YRDVMLENYSNLVSVGYCCFKPEVIFKLEQGEEPWFSEEEFSNQSHPKDYRGDDLIKQNKKIKDKHLEQA     71 - 140
ICINNKTLTTEEEKVLGKPFTLHVAAVASTKMSCKCNSWEVNLQSISEFIINNRNYSTKKIGCGNVCENS    141 - 210
PFKINFEKTQTGEKFYEHNKNMKALNYNENLPKHPKFQTLEQAFECNKIGKAFNDKANCVKHNSSHTGET    211 - 280
SSKDDEFRKNCDKKTLFDHRRTGTGKKHLHLNQCGKSFEKSTVEEYNKLNMGIKHYELNPSGNNFNRKAH    281 - 350
LTDPQTAVIEENPLVSNDRTQTWVKSSEYHENKKSYQTSVHRVRRRSHSMMKPYKCNECGKSFCQKGHLI    351 - 420
QHQRTHTGEKPFECSECGKTFSQKSHLSTHQRIHTAEKPYKCNECGKTFVQKSTLRGHQRIHTGEKPYEC    421 - 490
SECGKTFVQKSTLRDHHRIHTGEKSFQCNQCGKTFGQKSNLRIHQRTHTGEKTYQCNECEKSFWRKDHLI    491 - 560
QHQKTHTGEKPFKCNECGKTFARTSTLRVHQRIHTGEKPFKCNECGKKFVRKAILSDHQRIHTGEKPFQC    561 - 630
NKCGKTFGQKSNLRIHQRTHSGEKSYECNEYGKLCKKSTLSLYQKIQGEGNPY                     631 - 683
//

Text Mined References (9)

PMID Year Title
21497587 2011 Salivary zinc finger protein 510 peptide as a novel biomarker for detection of oral squamous cell carcinoma in early stages.
20977275 2011 Protein microarray signature of autoantibody biomarkers for the early detection of breast cancer.
19030899 2009 Genome-wide association scan for stature in Chinese: evidence for ethnic specific loci.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.