Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.52
PubTator Score 3.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -1.800 3.3e-04
astrocytic glioma -1.300 3.0e-02
Astrocytoma, Pilocytic -1.400 2.7e-05
atypical teratoid / rhabdoid tumor -1.400 2.0e-03
colon cancer -2.600 4.6e-03
cutaneous lupus erythematosus -1.100 5.1e-03
dermatomyositis 1.500 1.4e-03
ependymoma -1.500 2.4e-02
glioblastoma -1.300 1.1e-04
group 3 medulloblastoma -1.600 3.1e-03
intraductal papillary-mucinous carcinoma... 1.200 3.7e-02
lung cancer 1.900 1.3e-04
medulloblastoma, large-cell -1.900 4.4e-06
Multiple myeloma 3.130 2.4e-03
oligodendroglioma -1.300 3.0e-02
osteosarcoma 1.154 3.5e-03
ovarian cancer 1.800 6.5e-03
primitive neuroectodermal tumor -1.100 1.5e-02
psoriasis 1.600 1.6e-04
subependymal giant cell astrocytoma -2.885 2.7e-02
tuberculosis and treatment for 3 months 1.200 1.9e-05
ulcerative colitis -1.100 4.7e-06

Synonym

Accession Q9Y2F9 D3DW19 Q5JY73
Symbols dJ742J24.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MVDDKEKNMKCLTFFLMLPETVKNRSKKSSKKANTSSSSSNSSKLPPVCYEIITLKTKKKKMAADIFPRK      1 - 70
KPANSSSTSVQQYHQQNLSNNNLIPAPNWQGLYPTIRERNAMMFNNDLMADVHFVVGPPGGTQRLPGHKY     71 - 140
VLAVGSSVFHAMFYGELAEDKDEIRIPDVEPAAFLAMLKYIYCDEIDLAADTVLATLYAAKKYIVPHLAR    141 - 210
ACVNFLETSLSAKNACVLLSQSCLFEEPDLTQRCWEVIDAQAELALKSEGFCDIDFQTLESILRRETLNA    211 - 280
KEIVVFEAALNWAEVECQRQDLALSIENKRKVLGKALYLIRIPTMALDDFANGAAQSGVLTLNETNDIFL    281 - 350
WYTAAKKPELQFVSKARKGLVPQRCHRFQSCAYRSNQWRYRGRCDSIQFAVDKRVFIAGFGLYGSSCGSA    351 - 420
EYSAKIELKRQGVVLGQNLSKYFSDGSSNTFPVWFEYPVQIEPDTFYTASVILDGNELSYFGQEGMTEVQ    421 - 490
CGKVTVQFQCSSDSTNGTGVQGGQIPELIFYA                                          491 - 522
//

Text Mined References (12)

PMID Year Title