Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.75
PubTator Score 3.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 4.97458106574987E-10
medulloblastoma, large-cell 6234 4.43688591712027E-6
ulcerative colitis 2087 4.73189315363324E-6
pilocytic astrocytoma 3086 2.52543467128695E-5
group 4 medulloblastoma 1875 6.09902351865533E-5
lung cancer 4473 1.29542337328074E-4
psoriasis 6685 1.61370540025742E-4
glioblastoma 5572 1.84541260785012E-4
tuberculosis and treatment for 6 months 686 3.17815896947526E-4
adult high grade glioma 2148 3.27278649821967E-4
dermatomyositis 967 0.00140389017311118
atypical teratoid / rhabdoid tumor 4369 0.0019712312671855
Multiple myeloma 1328 0.00238982597345022
osteosarcoma 7933 0.0035193507668566
colon cancer 1475 0.00458896820012405
cutaneous lupus erythematosus 1056 0.00505649585088128
ovarian cancer 8492 0.00650470397223379
primitive neuroectodermal tumor 3031 0.0149228588755713
subependymal giant cell astrocytoma 2287 0.0272625938537092
astrocytic glioma 2241 0.0297342405294564
oligodendroglioma 2849 0.0302464237006945
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0373262040273397

Expression

  Differential Expression (22)

Synonym

Accession Q9Y2F9 D3DW19 Q5JY73
Symbols dJ742J24.1

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (2)

PMID Text
21720722 BTBD3 is repressed by miR-9 and -181c, either alone or in combination.
20463552 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MVDDKEKNMKCLTFFLMLPETVKNRSKKSSKKANTSSSSSNSSKLPPVCYEIITLKTKKKKMAADIFPRK      1 - 70
KPANSSSTSVQQYHQQNLSNNNLIPAPNWQGLYPTIRERNAMMFNNDLMADVHFVVGPPGGTQRLPGHKY     71 - 140
VLAVGSSVFHAMFYGELAEDKDEIRIPDVEPAAFLAMLKYIYCDEIDLAADTVLATLYAAKKYIVPHLAR    141 - 210
ACVNFLETSLSAKNACVLLSQSCLFEEPDLTQRCWEVIDAQAELALKSEGFCDIDFQTLESILRRETLNA    211 - 280
KEIVVFEAALNWAEVECQRQDLALSIENKRKVLGKALYLIRIPTMALDDFANGAAQSGVLTLNETNDIFL    281 - 350
WYTAAKKPELQFVSKARKGLVPQRCHRFQSCAYRSNQWRYRGRCDSIQFAVDKRVFIAGFGLYGSSCGSA    351 - 420
EYSAKIELKRQGVVLGQNLSKYFSDGSSNTFPVWFEYPVQIEPDTFYTASVILDGNELSYFGQEGMTEVQ    421 - 490
CGKVTVQFQCSSDSTNGTGVQGGQIPELIFYA                                          491 - 522
//

Text Mined References (12)

PMID Year Title
25060954 2014 Salt-inducible kinase 3, SIK3, is a new gene associated with hearing.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21720722 2012 Target gene repression mediated by miRNAs miR-181c and miR-9 both of which are down-regulated by amyloid-?.
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
20463552 2010 Genome-wide examination of genetic variants associated with response to platinum-based chemotherapy in patients with small-cell lung cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
More...