Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.49
PubTator Score 5.87

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.200 9.2e-03
group 4 medulloblastoma -1.600 4.6e-04
lung cancer -1.100 1.1e-03
malignant mesothelioma -1.300 8.4e-07
medulloblastoma, large-cell -1.900 2.9e-05
non primary Sjogren syndrome sicca 1.300 2.9e-02
osteosarcoma -2.110 1.4e-04
ovarian cancer -1.500 6.7e-06
psoriasis -1.300 8.6e-04

Gene RIF (21)

AA Sequence

MGQLCWLPLLAPLLLLRPPGVQSAGPIRAFVVPHSHMDVGWVYTVQESMRAYAANVYTSVVEELARGQQR      1 - 70
RFIAVEQEFFRLWWDGVASDQQKYQVRQLLEEGRLEFVIGGQVMHDEAVTHLDDQILQLTEGHGFLYETF     71 - 140
GIRPQFSWHVDPFGASATTPTLFALAGFNAHLGSRIDYDLKAAMQEARGLQFVWRGSPSLSERQEIFTHI    141 - 210
MDQYSYCTPSHIPFSNRSGFYWNGVAVFPKPPQDGVYPNMSEPVTPANINLYAEALVANVKQRAAWFRTP    211 - 280
HVLWPWGCDKQFFNASVQFANMDPLLDHINSHAAELGVSVQYATLGDYFRALHALNVTWRVRDHHDFLPY    281 - 350
STEPFQAWTGFYTSRSSLKGLARRASALLYAGESMFTRYLWPAPRGHLDPTWALQQLQQLRWAVSEVQHH    351 - 420
DAITGTESPKVRDMYATHLASGMLGMRKLMASIVLDELQPQAPMAASSDAGPAGHFASVYNPLAWTVTTI    421 - 490
VTLTVGFPGVRVTDEAGHPVPSQIQNSTETPSAYDLLILTTIPGLSYRHYNIRPTAGAQEGTQEPAATVA    491 - 560
STLQFGRRLRRRTSHAGRYLVPVANDCYIVLLDQDTNLMHSIWERQSNRTVRVTQEFLEYHVNGDVKQGP    561 - 630
ISDNYLFTPGKAAVPAWEAVEMEIVAGQLVTEIRQYFYRNMTAQNYTYAIRSRLTHVPQGHDGELLCHRI    631 - 700
EQEYQAGPLELNREAVLRTSTNLNSQQVIYSDNNGYQMQRRPYVSYVNNSIARNYYPMVQSAFMEDGKSR    701 - 770
LVLLSERAHGISSQGNGQVEVMLHRRLWNNFDWDLGYNLTLNDTSVVHPVLWLLLGSWSLTTALRQRSAL    771 - 840
ALQHRPVVLFGDLAGTAPKLPGPQQQEAVTLPPNLHLQILSIPGWRYSSNHTEHSQNLRKGHRGEAQADL    841 - 910
RRVLLRLYHLYEVGEDPVLSQPVTVNLEAVLQALGSVVAVEERSLTGTWDLSMLHRWSWRTGPGRHRGDT    911 - 980
TSPSRPPGGPIITVHPKEIRTFFIHFQQQ                                             981 - 1009
//

Text Mined References (16)

PMID Year Title