Property Summary

NCBI Gene PubMed Count 26
PubMed Score 17.79
PubTator Score 24.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.002
intraductal papillary-mucinous neoplasm ... 4.000 0.000
colon cancer -2.000 0.005
active Crohn's disease 1.366 0.024
active ulcerative colitis 2.000 0.004
lung carcinoma 1.700 0.000
Breast cancer -1.100 0.017
pituitary cancer 1.200 0.000
psoriasis -1.600 0.000

Synonym

Accession Q9Y2C3 A8KA86 D3DSI3 Q2M3L5 Q53Z19 Q9NY96 Q9P1X6 Q9P1X7 Beta-1,3-GalTase 5
Symbols B3T5
GLCT5
B3GalTx
B3GalT-V
beta3Gal-T5
beta-3-Gx-T5
beta-1,3-GalTase 5

Gene

PANTHER Protein Class (2)

Gene RIF (13)

PMID Text
24128890 Data conclude that HNF1alpha/beta are necessary but insufficient to activate and regulate B3GALT5 LTR transcription, which depends on unknown regulatory elements that are active when methylated and located outside of and far from the LTR promoter.
22001559 Chromatin immunoprecipitation assays on beta3Gal-T5 promoter showed that histone H3K4 trymethylation, H3K79 dimethylation, and H3K9-14 acetylation are high in cells expressing the transcript.
20494980 The B3GALT5 promoter is activated by serum depletion according to promoter reporter assays in HEK 293 cells.
19567891 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19225246 We found beta3Gal-T4 and T5 enzymatic activity in ovarian cancer tissues, indicating that these enzymes are expressed at least in ovarian cancer
19136585 the enhanced expression of beta 3GalT5 is sufficient to promote in vivo extension of type 1 chains by furnishing a significantly higher amount of type 1 chain precursors relative to competing type 2 chains.
16112824 case study of the endogenous retrovirus long terminal repeat promoter of this enzyme
15263012 2.3-kb 5'-flanking region of the human beta-1,4-GalT V gene was cloned and the region -116/-18 relative to the transcription start site as that having promoter activity.
2829950 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
2649653 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
More...

AA Sequence

MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQL      1 - 70
AERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIE     71 - 140
WVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRY    141 - 210
PPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRR    211 - 280
IVACHFIKPRTLLDYWQALENSRGEDCPPV                                            281 - 310
//

Text Mined References (27)

PMID Year Title
24128890 2014 Transcriptional control of the B3GALT5 gene by a retroviral promoter and methylation of distant regulatory elements.
22101162 2012 Decreased salivary sulphotransferase activity correlated with inflammation and autoimmunity parameters in Sjogren's syndrome patients.
22001559 2012 DNA methylation and histone modifications modulate the ?1,3 galactosyltransferase ?3Gal-T5 native promoter in cancer cells.
21041247 2010 Genome-wide association study of suicide attempts in mood disorder patients.
20494980 2010 Functional analysis and identification of cis-regulatory elements of human chromosome 21 gene promoters.
19567891 2009 Genetic utility of broadly defined bipolar schizoaffective disorder as a diagnostic concept.
19225246 2009 Beta1,3-galactosyltransferases-4/5 are novel tumor markers for gynecological cancers.
19136585 2009 Enhanced expression of beta 3-galactosyltransferase 5 activity is sufficient to induce in vivo synthesis of extended type 1 chains on lactosylceramides of selected human colonic carcinoma cell lines.
17212986 2007 Fold-recognition and comparative modeling of human beta3GalT I, II, IV, V and VI and beta3GalNAcT I: prediction of residues conferring acceptor substrate specificity.
17107959 2007 Comparative analysis of retroviral and native promoters driving expression of beta1,3-galactosyltransferase beta3Gal-T5 in human and mouse tissues.
More...