Property Summary

NCBI Gene PubMed Count 26
PubMed Score 18.26
PubTator Score 24.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.366 2.4e-02
active ulcerative colitis 2.000 4.5e-03
atypical teratoid / rhabdoid tumor 1.100 1.7e-03
Breast cancer -1.100 1.7e-02
colon cancer -2.000 5.1e-03
intraductal papillary-mucinous neoplasm ... 3.200 3.4e-04
lung carcinoma 1.700 5.0e-27
pituitary cancer 1.100 7.7e-04
psoriasis -1.600 2.5e-33

 MGI Phenotype (1)

Gene RIF (13)

AA Sequence

MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQL      1 - 70
AERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIE     71 - 140
WVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRY    141 - 210
PPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRR    211 - 280
IVACHFIKPRTLLDYWQALENSRGEDCPPV                                            281 - 310
//

Text Mined References (27)

PMID Year Title