Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.20
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 4.91701893518123E-7
Atopic dermatitis 944 7.30401120323516E-4
medulloblastoma, large-cell 6234 0.00170989249766519
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00456076993175135

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.752 0.000
medulloblastoma, large-cell -1.400 0.002
Atopic dermatitis 1.100 0.001
intraductal papillary-mucinous neoplasm ... 1.300 0.005

Synonym

Accession Q9Y2B5
Symbols ATP-BL
C16orf7

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

AA Sequence

MAAAAGDGTVKPLQSAMKLANGAIELDTGNRPREAYTEYLRSIHYISQVLLEEVETTKEAGETVPPDTSK      1 - 70
MLKLAQQCLERAQSTAAKLGKTRLKPTMPAAAPIPQPAGRHRRVYSDEGGKLSPFLPPEIFQKLQGAESQ     71 - 140
SCKKELTPLEEASLQNQKLKAAYEARMARLDPSQAMQKTSLTLSLQRQMMENLVIAKAREETLQRKMEER    141 - 210
RLRLQEAANRRFCSQVALTPEEREQRALYAAILEYEQDHDWPKHWKAKLKRNPGDLSLVTSLVSHLLSLP    211 - 280
DHPIAQLLRRLQCSVYSALYPAVSRAAAPAPGCCPPTPNPGSRRLRPSQSLHCMLSPPEPSAAPRPQDSP    281 - 350
PTPPLQPGPVGSPSPLGDTASGLPDKDSSFEDLEQFLGTSERQGRGRGVQPEPQLQQLKTAVEEIHNAVD    351 - 420
RLLSLTLLAFEGLNTAASKDRCLACIEEPFFSPLWPLLLALYRSVHRAREAALSRSMELYRNAPPTAIGI    421 - 490
PTKLLPQNPEAKGATGYPYCAAAQELGLLVLESCPQKKLECIVRTLRIICVCAEDYCPTPEATPQAGPPP    491 - 560
IAAAAIGADDLLPILSFVVLRSGLPQLVSECAALEEFIHEGYLIGEEGYCLTSLQSALSYVELLPRGGLA    561 - 630
K//

Text Mined References (5)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10231027 1999 Isolation and mapping of a putative b subunit of human ATP synthase (ATP-BL) from human leukocytes.