Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 5.3e-08
tuberculosis 2010 8.6e-07
osteosarcoma 7950 9.9e-07
ulcerative colitis 1819 1.5e-06
ovarian cancer 8520 6.2e-05
psoriasis 6694 2.9e-04
interstitial cystitis 2312 6.9e-04

Expression

  Differential Expression (7)

Disease log2 FC p
interstitial cystitis -1.500 6.9e-04
malignant mesothelioma -3.700 5.3e-08
osteosarcoma -1.905 9.9e-07
ovarian cancer -1.100 6.2e-05
psoriasis -1.700 2.9e-04
tuberculosis 1.400 8.6e-07
ulcerative colitis -1.700 1.5e-06

Gene RIF (2)

AA Sequence

MMLGSLAPDPGSRRHSGQAALRPRRYPTLWDRCRKRWLRPIFTQLLAAGLAYHTLLPIPSEPLFAAPGEH      1 - 70
LHQCFVKESYCPPRVLAKEQ                                                       71 - 90
//

Text Mined References (8)

PMID Year Title