Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y2A0 D6W5P2 Q52MB0 Q9Y2A1 Q9Y2A2 Q9Y2A3
Symbols P53TG1
TP53AP1
P53TG1-D
LINC00096
NCRNA00096

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
25882097 From our analysis, variants in the genes ABCB4, TP53AIP1, ARHGAP32 and TMEM88B were identified linked to the alexithymia phenotype.

AA Sequence

MMLGSLAPDPGSRRHSGQAALRPRRYPTLWDRCRKRWLRPIFTQLLAAGLAYHTLLPIPSEPLFAAPGEH      1 - 70
LHQCFVKESYCPPRVLAKEQ                                                       71 - 90
//

Text Mined References (7)

PMID Year Title
25882097 2015 Analysis of functional variants reveals new candidate genes associated with alexithymia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9713990 1998 Isolation of a novel TP53 target gene from a colon cancer cell line carrying a highly regulated wild-type TP53 expression system.