Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.02169695806035E-22
atypical teratoid / rhabdoid tumor 4369 6.88820047484672E-5
osteosarcoma 7933 8.93031025528296E-5
Multiple myeloma 1328 6.64967737947484E-4
lung cancer 4473 0.00952708888596623
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0175799052337916
active ulcerative colitis 477 0.0291348607921395

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.183 0.001
osteosarcoma -1.194 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.006 0.018
lung cancer 1.800 0.010
active ulcerative colitis -1.071 0.029
lung carcinoma 1.100 0.000

Synonym

Accession Q9Y291 MRP-S33
Symbols S33mt
PTD003
CGI-139
MRP-S33

Gene

PDB

3J9M  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGL      1 - 70
YRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKRK                                       71 - 106
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
More...