Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
active ulcerative colitis -1.071 2.9e-02
atypical teratoid / rhabdoid tumor -1.200 6.9e-05
lung cancer 1.800 9.5e-03
lung carcinoma 1.100 1.0e-22
Multiple myeloma 1.183 6.6e-04
osteosarcoma -1.194 8.9e-05
pancreatic ductal adenocarcinoma liver m... -1.006 1.8e-02

Gene RIF (1)

AA Sequence

MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGL      1 - 70
YRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKRK                                       71 - 106
//

Text Mined References (16)

PMID Year Title