Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.45
PubTator Score 5.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis -1.200 0.019
Multiple myeloma 1.587 0.002
cutaneous lupus erythematosus -1.100 0.008
osteosarcoma 1.308 0.000
posterior fossa group B ependymoma 1.300 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
lung cancer 1.600 0.000
diabetes mellitus -1.100 0.004
Breast cancer 2.400 0.042
sonic hedgehog group medulloblastoma 1.300 0.000
ovarian cancer 1.500 0.002

Synonym

Accession Q9Y282 Q5JWS3 Q6ZWP7 Q9H276 Q9P1L3
Symbols Erv46
CGI-54
PRO0989
C20orf47
NY-BR-84
SDBCAG84
dJ477O4.2

Gene

Gene RIF (5)

PMID Text
26177443 Results showed that miR-203a downregulation induced ERGIC3 overexpression in non-small cell lung cancer cells.
23374247 ERGIC3 may play an active role in the development and progression of lung cancer.
23212913 miR-490-3p modulates cell growth and epithelial to mesenchymal transition of hepatocellular carcinoma cells by targeting endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3).
22190034 HIV-1 gp160 is identified to have a physical interaction with ERGIC and golgi 3 (ERGIC3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
17020792 Plays important roles in cell growth and endoplasmic reticulum stress-induced cell death.

AA Sequence

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKI      1 - 70
NIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPD     71 - 140
RCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKV    141 - 210
AGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFV    211 - 280
KVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCA    281 - 350
IIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT                                         351 - 383
//

Text Mined References (23)

PMID Year Title
26177443 2015 ERGIC3, which is regulated by miR-203a, is a potential biomarker for non-small cell lung cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23374247 2013 Suppression subtractive hybridization identified differentially expressed genes in lung adenocarcinoma: ERGIC3 as a novel lung cancer-related gene.
23212913 2013 miR-490-3p modulates cell growth and epithelial to mesenchymal transition of hepatocellular carcinoma cells by targeting endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
More...