Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.92
PubTator Score 16.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.700 1.2e-06
astrocytic glioma -1.500 1.9e-02
Astrocytoma, Pilocytic -1.300 3.0e-06
atypical teratoid / rhabdoid tumor -1.600 6.7e-05
dermatomyositis 1.200 1.7e-03
ependymoma -1.700 2.8e-02
glioblastoma -1.300 6.1e-07
group 4 medulloblastoma -2.000 8.7e-08
juvenile dermatomyositis 1.237 6.3e-12
medulloblastoma, large-cell -1.500 2.1e-04
osteosarcoma 1.272 5.9e-05
ovarian cancer -1.800 2.5e-06
Waldenstrons macroglobulinemia 1.023 4.3e-02

Protein-protein Interaction (4)

Gene RIF (5)

AA Sequence

MGRIGISCLFPASWHFSISPVGCPRILNTNLRQIMVISVLAAAVSLLYFSVVIIRNKYGRLTRDKKFQRY      1 - 70
LARVTDIEATDTNNPNVNYGIVVDCGSSGSRVFVYCWPRHNGNPHDLLDIRQMRDKNRKPVVMKIKPGIS     71 - 140
EFATSPEKVSDYISPLLNFAAEHVPRAKHKETPLYILCTAGMRILPESQQKAILEDLLTDIPVHFDFLFS    141 - 210
DSHAEVISGKQEGVYAWIGINFVLGRFEHIEDDDEAVVEVNIPGSESSEAIVRKRTAGILDMGGVSTQIA    211 - 280
YEVPKTVSFASSQQEEVAKNLLAEFNLGCDVHQTEHVYRVYVATFLGFGGNAARQRYEDRIFANTIQKNR    281 - 350
LLGKQTGLTPDMPYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPP    351 - 420
IHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILRERFDRGLYASHADLHRLKYQC    421 - 490
FKSAWMFEVFHRGFSFPVNYKSLKTALQVYDKEVQWTLGAILYRTRFLPLRDIQQEAFRASHTHWRGVSF    491 - 560
VYNHYLFSGCFLVVLLAILLYLLRLRRIHRRTPRSSSAAALWMEEGLPAQNAPGTL                  561 - 616
//

Text Mined References (14)

PMID Year Title