Property Summary

NCBI Gene PubMed Count 79
Grant Count 40
R01 Count 13
Funding $5,760,458.47
PubMed Score 317.64
PubTator Score 123.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (56)

PMID Text
26974155 results suggest that LNK suppresses IL-7R/JAK/STAT signaling to restrict pro-/pre-B progenitor expansion and leukemia development, providing a pathogenic mechanism and a potential therapeutic approach for B-ALLs with LNK mutations.
26717315 LNK/SH2B3 is a key driver gene for human hypertension, and alteration of LNK in animal models has a profound effect on inflammation and hypertension. Thus, LNK is a potential therapeutic target for this disease and its devastating consequences.
26660394 A number of mutations in LNK have been described in a variety of myeloproliferative neoplasms some of which have been demonstrated to cause increased cellular proliferation.
26621817 Meta-analysis of genome-wide association studies identifies common susceptibility polymorphisms for colorectal and endometrial cancer near SH2B3 and TSHZ1.
26535636 the minor allele A of rs3184504 (A vs G, OR = 1.18, 95%CI = 1.12-1.24, P < 0.001) in SH2B3 significantly increased celiac disease susceptibility (Meta-Analysis)
26319099 Genetic variations in inflammation and its related subpathway components are keys to the development of lung, colorectal, ovary, and breast cancer, including SH2B3, which is associated with lung, colorectal, and breast cancer.
25231511 The single-nucleotide polymorphism in SH2B3 was significantly associated with Hypertension in an Algerian population sample.
24704825 in contrast to the findings in hematologic malignancies, the adaptor protein LNK acts as a positive signal transduction modulator in ovarian cancers.
24297922 IL-11 therefore drives a pathway that enhances HSPC radioresistance and radiation-induced B-cell malignancies, but is normally attenuated by the inhibitory adaptor Lnk.
23908464 Overall, these results demonstrate a Knudson tumor suppressor role for SH2B3 in the pathogenesis of acute lymphoblastic leukemia
More...

AA Sequence

MNGPALQPSSPSSAPSASPAAAPRGWSEFCELHAVAAARELARQYWLFAREHPQHAPLRAELVSLQFTDL      1 - 70
FQRYFCREVRDGRAPGRDYRDTGRGPPAKAEASPEPGPGPAAPGLPKARSSEELAPPRPPGPCSFQHFRR     71 - 140
SLRHIFRRRSAGELPAAHTAAAPGTPGEAAETPARPGLAKKFLPWSLAREPPPEALKEAVLRYSLADEAS    141 - 210
MDSGARWQRGRLALRRAPGPDGPDRVLELFDPPKSSRPKLQAACSSIQEVRWCTRLEMPDNLYTFVLKVK    211 - 280
DRTDIIFEVGDEQQLNSWMAELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDP    281 - 350
ACQKTDHFLSCYPWFHGPISRVKAAQLVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGIAKHLRLSLTE    351 - 420
RGQCRVQHLHFPSVVDMLHHFQRSPIPLECGAACDVRLSSYVVVVSQPPGSCNTVLFPFSLPHWDSESLP    421 - 490
HWGSELGLPHLSSSGCPRGLSPEGLPGRSSPPEQIFHLVPSPEELANSLQHLEHEPVNRARDSDYEMDSS    491 - 560
SRSHLRAIDNQYTPL                                                           561 - 575
//

Text Mined References (83)

PMID Year Title
26974155 2016 LNK/SH2B3 regulates IL-7 receptor signaling in normal and malignant B-progenitors.
26717315 2016 Linking inflammation and hypertension via LNK/SH2B3.
26660394 2016 LNK mutations and myeloproliferative disorders.
26621817 2015 Meta-analysis of genome-wide association studies identifies common susceptibility polymorphisms for colorectal and endometrial cancer near SH2B3 and TSHZ1.
26535636 2015 Association between IL2/IL21 and SH2B3 polymorphisms and risk of celiac disease: a meta-analysis.
26319099 2015 Cross Cancer Genomic Investigation of Inflammation Pathway for Five Common Cancers: Lung, Ovary, Prostate, Breast, and Colorectal Cancer.
25231511 2015 Effects of established blood pressure loci on blood pressure values and hypertension risk in an Algerian population sample.
25009551 2014 The ATXN2-SH2B3 locus is associated with peripheral arterial disease: an electronic medical record-based genome-wide association study.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24768677 2014 Genome-wide association study identifies variants associated with autoimmune hepatitis type 1.
More...