Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

NKSRKRRNRVSFLGAATVEPPKPIPLTWKTEKPVWVNQWPLPKQKLEALHLLANEQLEKGHIEPSFSPWN      1 - 70
SPVFVIQKKSGKWRMLTDLRAVNAVIQPMGPLQPGLPSPAMIPKDWPLIIIDLKDCFFTIPLAEQDCEKF     71 - 140
AFTIPAINNKEPATRFQWKVLPQGMLNSPTICQTFVGRALQPVREKFSDCYIIHYIDDILCAAETKDKLI    141 - 210
DCYTFLQAEVANAGLAIASDKIQTSTPFHYLGMQIENRKIKPQKIEIRKDTLKTLNDFQKLLGDINWIRP    211 - 280
TLGIPTYAMSNLFSILRGDSDLNSKRILTPEATKEIKLVEEKIQSAQINRIDPLAPLQLLIFATAHSPTG    281 - 350
IIIQNTDLVEWSFLPHSTVKTFTLYLDQIATLIGQTRLRIIKLCGNDPDKIVVPLTKEQVRQAFINSGAW    351 - 420
QIGLANFVGIIDNHYPKTKIFQFLKMTTWILPKITRREPLENALTVFTDGSSNGKAAYTGPKERVIKTPY    421 - 490
QSAQRAELVAVITVLQDFDQPINIISDSAYVVQATRDVETALIKYSMDDQLNQLFNLLQQTVRKRNFPFY    491 - 560
ITHIRAHTNLPGPLTKANEEADLLVSSALIKAQELHALTHVNAAGLKNKFDVTWKQAKDIVQHCTQCQVL    561 - 630
HLPTQEAGVNPRGLCPNALWQMDVTHVPSFGRLSYVHVTVDTYSHFIWATCQTGESTSHVKKHLLSCFAV    631 - 700
MGVPEKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQLVKQKEGGDSKECTT    701 - 770
PQMQLNLALYTLNFLNIYRNQTTTSAEQHLTGKKNSPHEGKLIWWKDNKNKTWEIGKVITWGRGFACVSP    771 - 840
GENQLPVWIPTRHLKFYNEPIGDAKKRASTEMVTPVTWMDNPIEVYVNDSVWVPGPTDDRCPAKPEEEGM    841 - 910
MINISIGYRYPPICLGRAPGCLMPTVQNWLVEVPIVSPICRFTYHMVSGMSLRPRVNYL               911 - 969
//

Text Mined References (5)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
20005155 2010 The prevalence of human endogenous retroviruses in cerebrospinal fluids from patients with sporadic Creutzfeldt-Jakob disease.
18664271 2008 Expression patterns of transcribed human endogenous retrovirus HERV-K(HML-2) loci in human tissues and the need for a HERV Transcriptome Project.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
9971820 1999 Identification of an active reverse transcriptase enzyme encoded by a human endogenous HERV-K retrovirus.