Property Summary

NCBI Gene PubMed Count 55
Grant Count 91
R01 Count 60
Funding $17,565,719.81
PubMed Score 652.16
PubTator Score 550.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma 1.400 0.005
adult high grade glioma -1.200 0.012
lung carcinoma 2.500 0.000
psoriasis -1.200 0.000

Synonym

Accession Q9UQF2 D3DQP4 O43407 JIP-1
Symbols IB1
JIP1
JIP-1
PRKM8IP

Gene

PDB

3OXI   3PTG   4H39   2G01   2GMX   2H96   3VUD   3VUG   3VUH   3VUI   3VUK   3VUL   3VUM   4E73   4G1W   4HYS   4HYU   4IZY  

Gene RIF (25)

PMID Text
23825109 analysis of the role of JIP1 in APP transport; knockdown of JIP1 did not affect either amyloid precursor protein transport or amyloid-beta peptide production
23770673 Data show that small GTPase RALA regulates formation of a JIP1 (C-Jun-amino-terminal-interacting protein 1) scaffold complex to propagate JNK signaling toward FOXO4 (forkhead box O transcription factor) in response to reactive oxygen species (ROS).
23360921 In resected pancreatic cancer, carriers of a minor allele for rs3824872 (MAPK8IP1) were associated with a survival advantage compared with noncarriers with an additional 2-year survival if both minor alleles were present.
23172226 Lysine 63-linked ubiquitination modulates mixed lineage kinase-3 interaction with JIP1 scaffold protein in cytokine-induced pancreatic beta cell death
21237154 Data suggest that caspase 3-mediated cleavage of JIP1 scaffold proteins may represent an important mechanism for modulation of JNK signalling during apoptotic cell death.
19616077 This review discusses the role of the JIP1 and the c-Jun NH(2)-terminal kinase pathway in the molecular pathogenesis of Alzheimer's and type 2 diabetes. JIP1 is a key regulator of the JNK pathway in neuronal and beta-cells.
19491104 The pathological Tau/JIP1 interaction requires phosphorylation of Tau, and Tau competes with the physiological binding of JIP1 to kinesin light chain.
18480379 Thyroid cancers are characterized by APP upregulation, increased membrane targeting of the APP ectodomain and significantly increased mRNA levels of the APP scaffold proteins JIP1, ShcA and Fe65.
18286207 the activity of JIP1-JNK complexes is downregulated by VRK2 in response to interleukin-1beta
17200414 Binding of JIP1 and FEZ1 to Kinesin-1 is sufficient to activate the motor for microtubule binding and motility.
More...

AA Sequence

MAERESGGLGGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISLQCKDTLSLRP      1 - 70
PRAGLLSAGGGGAGSRLQAEMLQMDLIDATGDTPGAEDDEEDDDEERAARRPGAGPPKAESGQEPASRGQ     71 - 140
GQSQGQSQGPGSGDTYRPKRPTTLNLFPQVPRSQDTLNNNSLGKKHSWQDRVSRSSSPLKTGEQTPPHEH    141 - 210
ICLSDELPPQSGPAPTTDRGTSTDSPCRRSTATQMAPPGGPPAAPPGGRGHSHRDRIHYQADVRLEATEE    211 - 280
IYLTPVQRPPDAAEPTSAFLPPTESRMSVSSDPDPAAYPSTAGRPHPSISEEEEGFDCLSSPERAEPPGG    281 - 350
GWRGSLGEPPPPPRASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASVS    351 - 420
SPYESAIGEEYEEAPRPQPPACLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCIINGEEQE    421 - 490
QTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKN    491 - 560
SDWVDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEISVRGVKIGVKADDSQEA    561 - 630
KGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVE    631 - 700
YTCPTEDIYLE                                                               701 - 711
//

Text Mined References (56)

PMID Year Title
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23825109 2013 Loss of c-Jun N-terminal kinase-interacting protein-1 does not affect axonal transport of the amyloid precursor protein or A? production.
23770673 2013 The small GTPase RALA controls c-Jun N-terminal kinase-mediated FOXO activation by regulation of a JIP1 scaffold complex.
23360921 2013 Survival is associated with genetic variation in inflammatory pathway genes among patients with resected and unresected pancreatic cancer.
23172226 2013 Lysine 63-linked ubiquitination modulates mixed lineage kinase-3 interaction with JIP1 scaffold protein in cytokine-induced pancreatic ? cell death.
21237154 2011 Disassembly of the JIP1/JNK molecular scaffold by caspase-3-mediated cleavage of JIP1 during apoptosis.
19616077 2009 Role of the JNK-interacting protein 1/islet brain 1 in cell degeneration in Alzheimer disease and diabetes.
19491104 2009 Phosphorylated Tau interacts with c-Jun N-terminal kinase-interacting protein 1 (JIP1) in Alzheimer disease.
18480379 2008 Evidence for a role of the amyloid precursor protein in thyroid carcinogenesis.
18286207 2008 Modulation of interleukin-1 transcriptional response by the interaction between VRK2 and the JIP1 scaffold protein.
More...