Property Summary

NCBI Gene PubMed Count 28
Grant Count 6
R01 Count 5
Funding $748,340.33
PubMed Score 90.35
PubTator Score 30.54

Knowledge Summary

Patent (15,807)

Expression

  Differential Expression (10)

Synonym

Accession Q9UQC9 A8K2T3 Q9Y6N2
Symbols CACC
CACC3
CLCRG2
CaCC-3

Gene

PANTHER Protein Class (2)

Gene RIF (16)

PMID Text
26930581 CLCA2 links junctional adhesion molecule EVA1, to cytosolic signaling proteins that modulate proliferation and differentiation.
25557950 Variants in CLCA2 were associated with an ileal involvement phenotype of Crohn's disease.
25548429 CLCA2 expression is higher in squamous cell carcinoma of the lung compared with adenocarcinoma.
22990203 These results strongly suggest that CLCA2 is involved in the p53 tumor suppressor network and has a significant effect on cell migration and invasion.
22431922 the reduced expression of CLCA2 was frequently observed in various kinds of cancers including prostate cancer
21909135 hCLCA2 is required for epithelial differentiation, and its loss during tumor progression contributes to metastasis.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19654313 hCLCA2 Is a p53-Inducible Inhibitor of Breast Cancer Cell Proliferation.
19423540 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MTQRSIAGPICNLKFVTLLVALSSELPFLGAGVQLQDNGYNGLLIAINPQVPENQNLISNIKEMITEASF      1 - 70
YLFNATKRRVFFRNIKILIPATWKANNNSKIKQESYEKANVIVTDWYGAHGDDPYTLQYRGCGKEGKYIH     71 - 140
FTPNFLLNDNLTAGYGSRGRVFVHEWAHLRWGVFDEYNNDKPFYINGQNQIKVTRCSSDITGIFVCEKGP    141 - 210
CPQENCIISKLFKEGCTFIYNSTQNATASIMFMQSLSSVVEFCNASTHNQEAPNLQNQMCSLRSAWDVIT    211 - 280
DSADFHHSFPMNGTELPPPPTFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFVG    281 - 350
IASFDSKGEIRAQLHQINSNDDRKLLVSYLPTTVSAKTDISICSGLKKGFEVVEKLNGKAYGSVMILVTS    351 - 420
GDDKLLGNCLPTVLSSGSTIHSIALGSSAAPNLEELSRLTGGLKFFVPDISNSNSMIDAFSRISSGTGDI    421 - 490
FQQHIQLESTGENVKPHHQLKNTVTVDNTVGNDTMFLVTWQASGPPEIILFDPDGRKYYTNNFITNLTFR    491 - 560
TASLWIPGTAKPGHWTYTLNNTHHSLQALKVTVTSRASNSAVPPATVEAFVERDSLHFPHPVMIYANVKQ    561 - 630
GFYPILNATVTATVEPETGDPVTLRLLDDGAGADVIKNDGIYSRYFFSFAANGRYSLKVHVNHSPSISTP    631 - 700
AHSIPGSHAMYVPGYTANGNIQMNAPRKSVGRNEEERKWGFSRVSSGGSFSVLGVPAGPHPDVFPPCKII    701 - 770
DLEAVKVEEELTLSWTAPGEDFDQGQATSYEIRMSKSLQNIQDDFNNAILVNTSKRNPQQAGIREIFTFS    771 - 840
PQISTNGPEHQPNGETHESHRIYVAIRAMDRNSLQSAVSNIAQAPLFIPPNSDPVPARDYLILKGVLTAM    841 - 910
GLIGIICLIIVVTHHTLSRKKRADKKENGTKLL                                         911 - 943
//

Text Mined References (33)

PMID Year Title
26930581 2016 CLCA2 Interactor EVA1 Is Required for Mammary Epithelial Cell Differentiation.
25557950 2015 Identification of risk loci for Crohn's disease phenotypes using a genome-wide association study.
25548429 2014 CLCA2 as a novel immunohistochemical marker for differential diagnosis of squamous cell carcinoma from adenocarcinoma of the lung.
23112050 2012 Self-cleavage of human CLCA1 protein by a novel internal metalloprotease domain controls calcium-activated chloride channel activation.
22990203 2012 CLCA2, a target of the p53 family, negatively regulates cancer cell migration and invasion.
22431922 2012 CLCA2 as a p53-inducible senescence mediator.
21909135 2012 Loss of breast epithelial marker hCLCA2 promotes epithelial-to-mesenchymal transition and indicates higher risk of metastasis.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19654313 2009 hCLCA2 Is a p53-Inducible Inhibitor of Breast Cancer Cell Proliferation.
More...