Property Summary

NCBI Gene PubMed Count 28
PubMed Score 95.16
PubTator Score 30.54

Knowledge Summary

Patent (15,807)

Expression

  Differential Expression (11)

Disease log2 FC p
cystic fibrosis 2.200 1.5e-04
active Crohn's disease 1.112 2.8e-02
cutaneous lupus erythematosus 1.200 4.6e-02
cystic fibrosis and chronic rhinosinusit... 1.067 7.1e-03
ductal carcinoma in situ 2.100 2.1e-02
esophageal adenocarcinoma -2.800 3.6e-02
malignant mesothelioma -2.400 1.8e-07
nasopharyngeal carcinoma -1.700 3.9e-02
non primary Sjogren syndrome sicca -1.200 2.4e-02
non-small cell lung cancer 2.760 7.1e-11
psoriasis 1.300 1.7e-05

Gene RIF (16)

AA Sequence

MTQRSIAGPICNLKFVTLLVALSSELPFLGAGVQLQDNGYNGLLIAINPQVPENQNLISNIKEMITEASF      1 - 70
YLFNATKRRVFFRNIKILIPATWKANNNSKIKQESYEKANVIVTDWYGAHGDDPYTLQYRGCGKEGKYIH     71 - 140
FTPNFLLNDNLTAGYGSRGRVFVHEWAHLRWGVFDEYNNDKPFYINGQNQIKVTRCSSDITGIFVCEKGP    141 - 210
CPQENCIISKLFKEGCTFIYNSTQNATASIMFMQSLSSVVEFCNASTHNQEAPNLQNQMCSLRSAWDVIT    211 - 280
DSADFHHSFPMNGTELPPPPTFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFVG    281 - 350
IASFDSKGEIRAQLHQINSNDDRKLLVSYLPTTVSAKTDISICSGLKKGFEVVEKLNGKAYGSVMILVTS    351 - 420
GDDKLLGNCLPTVLSSGSTIHSIALGSSAAPNLEELSRLTGGLKFFVPDISNSNSMIDAFSRISSGTGDI    421 - 490
FQQHIQLESTGENVKPHHQLKNTVTVDNTVGNDTMFLVTWQASGPPEIILFDPDGRKYYTNNFITNLTFR    491 - 560
TASLWIPGTAKPGHWTYTLNNTHHSLQALKVTVTSRASNSAVPPATVEAFVERDSLHFPHPVMIYANVKQ    561 - 630
GFYPILNATVTATVEPETGDPVTLRLLDDGAGADVIKNDGIYSRYFFSFAANGRYSLKVHVNHSPSISTP    631 - 700
AHSIPGSHAMYVPGYTANGNIQMNAPRKSVGRNEEERKWGFSRVSSGGSFSVLGVPAGPHPDVFPPCKII    701 - 770
DLEAVKVEEELTLSWTAPGEDFDQGQATSYEIRMSKSLQNIQDDFNNAILVNTSKRNPQQAGIREIFTFS    771 - 840
PQISTNGPEHQPNGETHESHRIYVAIRAMDRNSLQSAVSNIAQAPLFIPPNSDPVPARDYLILKGVLTAM    841 - 910
GLIGIICLIIVVTHHTLSRKKRADKKENGTKLL                                         911 - 943
//

Text Mined References (33)

PMID Year Title