Property Summary

NCBI Gene PubMed Count 102
Grant Count 90
R01 Count 72
Funding $5,761,946.32
PubMed Score 126.25
PubTator Score 105.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.302 0.000
Multiple myeloma 1.027 0.047
malignant mesothelioma 2.000 0.000
non-small cell lung cancer -1.280 0.000
fibroadenoma -1.200 0.007
lung adenocarcinoma -1.100 0.000
ductal carcinoma in situ -1.200 0.003
invasive ductal carcinoma -1.300 0.018
acute myeloid leukemia 1.300 0.018

Synonym

Accession Q9UQC2 A2RRM2 A6NEW9 A7MD36 O60317
Symbols

Gene

PDB

5EWZ   5EXA   2VWF   2W0Z  

Gene RIF (79)

PMID Text
27544933 Gab2 may be involved in the onset and progression of HCC, but its expression is unable to serve as an independent prognosis factor in HCC patients.
26754532 Study shows that Gab2 is significantly upregulated in metastasis-positive colorectal cancer (CRC) tissues and suggest that it plays a vital role in regulating CRC metastasis and a potential target for diagnosis.
26617767 Grb2-associated binder 2 silencing impairs growth and migration of non-small cell lung cancer cells via PI3K-Akt signaling.
26503584 GAB2, GSPT1, TFDP2 and ZFPM1 are four new susceptibility loci for testicular germ cell tumor.
26354435 In colorectal cancer, miR-125b mediates PAR2-induced cancer cell migration by targeting Gab2.
26045784 Gab2 expression may play an important role in the progression of colorectal carcinoma.
25852062 Data indicate that high-grade serous ovarian carcinoma (HGSC) cell lines with high GRB2 associated binding protein 2 (GAB2) expression are more responsive to phosphatidylinositol 3-kinases (PI3K) inhibitor PF-04691502.
25598421 miR125a-5p acting as a novel Gab2 suppressor is partly down- regulated by DNA hypermethylation in glioma
24998422 Upregulations of Gab1 and Gab2 proteins associate with tumor progression of human gliomas.
24805943 Down-regulation of Gab2 has a protective function during M. tuberculosis infection, revealing a potential negative regulatory role for Gab2 in immunity to TB.
More...

AA Sequence

MSGGGDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNDHSKKPLRIINLNFCEQVD      1 - 70
AGLTFNKKELQDSFVFDIKTSERTFYLVAETEEDMNKWVQSICQICGFNQAEESTDSLRNVSSAGHGPRS     71 - 140
SPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAENARSAS    141 - 210
FSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDSTYDLPRSLASHGHTKG    211 - 280
SLTGSETDNEDVYTFKTPSNTLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIA    281 - 350
PPPRPPKPSQAETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPQRGGESAG    351 - 420
RSAESMSDGVGSFLPGKMIVGRSDSTNSEDNYVPMNPGSSTLLAMERAGDNSQSVYIPMSPGAHHFDSLG    421 - 490
YPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELPFKSPITKSWSRANHTFNSSS    491 - 560
SQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGTNSPAPKKSTGSVDYLALDFQPSSPSPHRKP    561 - 630
STSSVTSDEKVDYVQVDKEKTQALQNTMQEWTDVRQSSEPSKGAKL                            631 - 676
//

Text Mined References (108)

PMID Year Title
27544933 2016 Expression Pattern and Clinical Significance of Gab2 Protein in Hepatocellular Carcinoma.
26754532 2016 Gab2 facilitates epithelial-to-mesenchymal transition via the MEK/ERK/MMP signaling in colorectal cancer.
26617767 2015 Grb2-associated binder 2 silencing impairs growth and migration of H1975 cells via modulation of PI3K-Akt signaling.
26503584 2015 Identification of four new susceptibility loci for testicular germ cell tumour.
26354435 2015 Proteinase-activated receptor 2 promotes cancer cell migration through RNA methylation-mediated repression of miR-125b.
26045784 2015 Gab2 is a novel prognostic factor for colorectal cancer patients.
25852062 2015 Enhanced GAB2 Expression Is Associated with Improved Survival in High-Grade Serous Ovarian Cancer and Sensitivity to PI3K Inhibition.
25598421 2016 MiR125a-5p acting as a novel Gab2 suppressor inhibits invasion of glioma.
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
More...