Property Summary

NCBI Gene PubMed Count 115
PubMed Score 139.78
PubTator Score 105.84

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 1.300 1.8e-02
Chronic Lymphocytic Leukemia 1.302 2.4e-04
ductal carcinoma in situ -1.200 2.7e-03
fibroadenoma -1.200 7.2e-03
invasive ductal carcinoma -1.300 1.8e-02
lung adenocarcinoma -1.100 4.4e-07
malignant mesothelioma 2.000 1.0e-07
Multiple myeloma 1.027 4.7e-02
non-small cell lung cancer -1.280 2.8e-19

Gene RIF (92)

AA Sequence

MSGGGDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNDHSKKPLRIINLNFCEQVD      1 - 70
AGLTFNKKELQDSFVFDIKTSERTFYLVAETEEDMNKWVQSICQICGFNQAEESTDSLRNVSSAGHGPRS     71 - 140
SPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAENARSAS    141 - 210
FSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDSTYDLPRSLASHGHTKG    211 - 280
SLTGSETDNEDVYTFKTPSNTLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIA    281 - 350
PPPRPPKPSQAETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPQRGGESAG    351 - 420
RSAESMSDGVGSFLPGKMIVGRSDSTNSEDNYVPMNPGSSTLLAMERAGDNSQSVYIPMSPGAHHFDSLG    421 - 490
YPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELPFKSPITKSWSRANHTFNSSS    491 - 560
SQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGTNSPAPKKSTGSVDYLALDFQPSSPSPHRKP    561 - 630
STSSVTSDEKVDYVQVDKEKTQALQNTMQEWTDVRQSSEPSKGAKL                            631 - 676
//

Text Mined References (121)

PMID Year Title