Property Summary

NCBI Gene PubMed Count 69
PubMed Score 87.88
PubTator Score 75.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.1751931951179E-7
glioblastoma 5572 6.46832888655324E-6
psoriasis 6685 1.3196289061639E-4
pilocytic astrocytoma 3086 1.45472872856801E-4
Atopic dermatitis 944 2.48786864854102E-4
medulloblastoma, large-cell 6234 3.11229333332226E-4
osteosarcoma 7933 4.39055265251279E-4
ependymoma 2514 5.32261306631661E-4
primitive neuroectodermal tumor 3031 5.45396547228636E-4
adult high grade glioma 2148 0.00211081333028911
oligodendroglioma 2849 0.00250852383972806
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00253298624981677
astrocytic glioma 2241 0.00300229867834001
medulloblastoma 1524 0.0035260447537514
Pick disease 1893 0.00791657933795288
esophageal adenocarcinoma 737 0.0176010007179145

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.700 0.003
ependymoma -2.100 0.001
oligodendroglioma -1.900 0.003
esophageal adenocarcinoma -1.300 0.018
psoriasis 2.300 0.000
glioblastoma -1.500 0.000
osteosarcoma 1.228 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma 1.200 0.004
medulloblastoma, large-cell 1.400 0.000
primitive neuroectodermal tumor -1.900 0.001
Atopic dermatitis 1.100 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.003
adult high grade glioma -1.600 0.002
pilocytic astrocytoma -1.400 0.000
Pick disease -1.100 0.008

Synonym

Gene

PANTHER Protein Class (1)

PDB

1WDZ   1Y2O   2YKT   3RNJ   4JS0  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

 GWAS Trait (1)

Gene RIF (36)

PMID Text
26469246 dimers sense negative membrane curvature, display a non-monotonic sorting with curvature, and expand the membrane tube at high imposed tension while constricting it at low tension
26275848 Results suggest the hypothesis that defective actin/membrane modulation in IRSp53-deficient dendritic spines may lead to social and cognitive deficits through N-methyl-d-aspartate receptor dysfunction.
26018170 HIV-1 Gag is required by RAC1-WASF2-BAIAP2-ARP3 pathway for HIV VLP production/release from Jurkat T lymphocytes
26018170 HIV-1 VLP production/release from Jurkat T lymphocytes requires an intact RAC1-WASF2-BAIAP2-ARP3 pathway as demonstrated by siRNA knockdown experiments
25031323 determined the alpha-synuclein-binding domain of beta-III tubulin and demonstrated that a short fragment containing this domain can suppress alpha-synuclein accumulation in the primary cultured cells
24584464 IRSp53 adopts a closed inactive conformation that opens synergistically with the binding of human Cdc42 to the CRIB-PR and effector proteins, such as the tumor-promoting factor Eps8, to the SH3 domain.
24392092 BAIAP2 is related to emotional modulation of human memory strength.
24377651 These above results indicated the possible involvement of BAIAP2 in the etiology of attention deficit disorder with hyperactivity, especially ADHD-I.
22767515 LIN7 is a novel regulator of IRSp53.
22179776 mDia1 and WAVE2 are important Src homology 3 domain partners of IRSp53 in forming filopodia.
More...

AA Sequence

MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSK      1 - 70
ELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAE     71 - 140
LKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAA    141 - 210
YHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVP    211 - 280
PELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPK    281 - 350
NSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK    351 - 420
TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRP    421 - 490
YSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR            491 - 552
//

Text Mined References (76)

PMID Year Title
26469246 2015 IRSp53 senses negative membrane curvature and phase separates along membrane tubules.
26275848 2016 IRSp53/BAIAP2 in dendritic spine development, NMDA receptor regulation, and psychiatric disorders.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25031323 2014 Dynamin1 is a novel target for IRSp53 protein and works with mammalian enabled (Mena) protein and Eps8 to regulate filopodial dynamics.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24584464 2014 Mechanism of IRSp53 inhibition and combinatorial activation by Cdc42 and downstream effectors.
24392092 2014 BAIAP2 is related to emotional modulation of human memory strength.
More...