Property Summary

NCBI Gene PubMed Count 72
PubMed Score 91.56
PubTator Score 75.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.400 6.0e-03
astrocytic glioma -1.100 7.3e-03
Astrocytoma, Pilocytic -1.500 2.0e-04
Atopic dermatitis 1.100 2.5e-04
atypical teratoid / rhabdoid tumor -2.200 2.2e-07
ependymoma -1.100 1.3e-02
esophageal adenocarcinoma -1.300 1.8e-02
glioblastoma -1.400 8.2e-06
group 4 medulloblastoma 1.100 2.0e-03
intraductal papillary-mucinous adenoma (... 1.100 2.5e-03
medulloblastoma, large-cell 1.400 3.1e-04
oligodendroglioma -1.200 2.6e-02
osteosarcoma 1.228 4.4e-04
Pick disease -1.100 7.9e-03
primitive neuroectodermal tumor -1.900 5.5e-04
psoriasis 2.300 1.3e-04

Protein-protein Interaction (6)

Gene RIF (38)

AA Sequence

MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSK      1 - 70
ELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAE     71 - 140
LKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAA    141 - 210
YHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVP    211 - 280
PELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPK    281 - 350
NSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK    351 - 420
TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRP    421 - 490
YSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR            491 - 552
//

Text Mined References (79)

PMID Year Title